DVM-system of parallel program development . Installation guide . ... 1.2 Installation of binary version of DVM-system . ... DVM-system is delivered in two variants: as source files (file dvmNNN.tar.gz ) and as binary version - executable programs and libraries (file dvmNNN_win.zip ). ... If you intend to work with DVM-system on single computer (development and debugging of DVM-programs), you can use implementation MPICHWIN (file mpichwin.zip ) from our site ( www.keldysh.ru/dvm ). ...

Еще в разделе: (Показать все результаты (>95) - sp.cs.msu.ru/ )

• DVM-system. Installation guide. Version 3.95
• Debugging DVM-program. User's guide. Part 1
• Debugging DVM-program. User's guide. Part 2

Title Author Key words Inequality in the era of globalization: essence, institutions, regional specificity and dynamics Osipova N.G. social inequality, era of globalization, ideology of globalism, agents of globalism, institutions of globalism, neo-liberal values, global inequality, regional characteristics of global inequality, sociology The paper examines the problems of social inequality in the era of globalization. ... Sociology possibilities in softening of an existing inequality are considered. ...

Еще в разделе: (Показать все результаты (>35) - www.socio.msu.ru/ )

• Главная - Социологический факультет МГУ

... 2013 тАФ Academic Writing: Russian and International Experience (Moscow) . ... 2009 тАФ Media Imagination (Moscow) . 2008 тАФ University Among the Media: Innovation in Higher Learning and Changing Modes of Effective Communication (Moscow) . ... 2003 тАФ Reading Everyday Life in American and in Russian: Semiotics of Culture and Intercultural Communication (Yasnaya Polyana) . 2002 тАФ Popular Literature: American and Russian Experience in Cultural Myth-Making (Moscow) . ... Summer School 2016 . ...

Еще в разделе: (Показать все результаты (>3) - discours.philol.msu.ru/ )

... H. Purcell: The Fairy Queen - Act II . Г. Перселл: Королева фей - Акт II . Act I . ... The fairies entertain their queen with songs dances until Titania asks them to sing her a lullaby: immediately four allegorical figures - Night, Mystery, Secresie and Sleep - approach to do her bidding. ... Феи развлекают свою королеву песнями и танцами, пока она не просит спеть ей колыбельную: тотчас же четыре аллегорические фигуры - Ночь, Тайна, Секрет и Сон - приближаются, чтобы выполнить ее приказания. ...

Еще в разделе: (Показать все результаты (>25) - music.genebee.msu.ru/ )

• C. Gibbons, M. Locke: Cupid and Death - Entry 4
• J.-B. Lully: Cadmus et Hermione - Acte V

EmTeX files . CHANGES.ENG CHANGES.GER DISKETTE.DOC HELP.ENG HELP.GER INSTALL.ENG INSTALL.GER QUICK.ENG QUICK.GER README.BET README.ENG README.GER . bibtex4b.zip bj_base.fli dj_base.fli dvid16h1.zip dvid16h2.zip dvisp10b.zip emtex .html emxrsx.zip fax_base.fli first.zip fontams.zip fontcm.zip fontec.zip fontemsy.zip fontltx.zip fx_base.fli german.zip install ...

Еще в разделе: (Показать все результаты (>4) - tex.bog.msu.ru/ )

... О Школе . ... ВШБ МГУ - школе . ... Выпуски журнала . Выпуск 1/2009 . ... Менеджмент Выпуски журнала Выпуск 1/2009 . ... В статье рассматривается необходимость пересмотра подходов к управлению бизнесом в условиях глубоких кардинальных изменений в экономике и обществе в целом. ... Vikhanskiy, O.S. PARADIGM S CHANGE FOR BUSINESS MANAGEMENT . ... Naumov, A. I. NO CRISIS FOR MANAGEMENT . ... A strategic alliance is a recent and not very well studied phenomenon in Russian business. ... Школа бизнеса . ...

Еще в разделе: (Показать все результаты (>71) - www.mgubs.ru/ )

• Состоялось годовое собрание Ассоциации развития менеджмента Центральной и
• Выпуск 2/2011 | Высшая школа бизнеса МГУ им. Ломоносова
• Варшавская школа экономики

... file but would like it to be automatically updated # again, run the following command: # sudo dpkg-reconfigure -phigh xserver-xorg Section Files EndSection Section InputDevice Identifier Generic Keyboard Driver kbd Option CoreKeyboard Option XkbRules xorg Option XkbModel pc105 Option XkbLayout us ...

Еще в разделе: (Показать все результаты (>14) - observ.pereplet.ru/ )

• http://observ.pereplet.ru/images/GRB081102/grb_film.html

... 1066 , , , . ... Origin of the English language (parent language, family tree, cognates) Practical application of knowledge in the field of language history. ... Changes in: - Grammar - Vocabulary General (stages of development) - Spelling - Phonetic systems 8. Periods of the English language historical development. ... English Alphabet: changes and development from Old English to Modern English. ... Cambridge University Press, 2003. ... Oxford University Press, 2001. the English language. ...

Еще в разделе: (Показать все результаты (>40) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/future-students/lingua-4-teens/tezis-filosof.pdf

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>5) - www.sciencepark.ru/ )

RADIO EMISSION OF THE MOON BEFORE AND AFTER THE LUNAR PROSPECTOR IMPACT Berezhnoi A.A.*, Gusev S.G.**, Khavroshkin O.B.***, Poperechenko B.A.**, Shevchenko V.V.*, Tzyplakov V.A.*** * Sternberg Astronomical Institute, Universitetskij pr., ... For the registration of lunar RSR after the Lunar Prospector impact radio observations of the Moon on the two 64-m radio telescopes of the SDO MEI at Medvezh'i Ozera and Kaliazin were conducted during July 30 - August 2, 1999. ...

Еще в разделе: (Показать все результаты (>70) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Shev/Publications/ms38/ms082.pdf
• http://selena.sai.msu.ru/Bus/Publications/m44_14_busarev_etal.pdf
• http://selena.sai.msu.ru/Symposium/lipskiy.doc

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>33) - cosmos.msu.ru/ )

• UNIVERSAT-2009: University Satellites in Space Sciences Education, Zvenigorod,
• Space Scientific and Education project of Lomonosov Moscow State University

Twilight observations with MASS/DIMM B. Safonov Sternberg Astronomical Institute Moscow State University Comprehensive Characterization of Astronomical Sites, 2010 B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 1 / 17 Why observe in twilight with MASS/DIMM? ... ASM includes 3 devices sensitive to background: guider, DIMM and MASS. B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 2 / 17 Background in guider. ...

Еще в разделе: (Показать все результаты (>12) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/Site2010-Summary.pdf
• Information

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Ultrastructural changes in the cell center during enterocyte differentiation in the mouse. Tsitologiia. ... Microtubule and intermediate filament patterns around the centrosome in interphase cells. ... The effect of the UV microirradiation of the centrosome on cell behavior. ... A stereoscopic analysis of the centrosome structure in tissue culture cells under the action of carbonyl cyanide p-trifluoromethoxyphenylhydrazone and ouabain Tsitologiia. ... Alieva IB, Vorob'ev IA, Chentsov YuS. ...

Еще в разделе: (Показать все результаты (>32) - cellmotility.genebee.msu.ru/ )

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>18) - curl.sai.msu.ru/ )

• . The . MASS . Group .

... 2) Place of the conference has been changed from the lecture hall V-3 to the lecture hall V-2 in the First Academic Building of MSU on New Territories (it is marked on the map of MSU campus on the web-site). ... 6) For participants from abroad Russia here is additional information about the money exchange - we would recommend you to bring at least 300-400 euro with you in cash because of the following considerations: . ... for one dinner in the evening you should calculate not less than 15-20 euro ....

Еще в разделе: (Показать все результаты (>108) - polly.phys.msu.ru/ )

• index
• PSMTLab - Collaboration
• Publications of V.Ya. Grinberg

... This button switches the current on. 2. to induce - to change continually or frequently. ... Wood is a poor conductor of heat. 4. to line up with - to cause to have a large amount of e.g. work to deal with.. ... His feelings fluctuated between excitement and fear. 6. putative -- smth that acts as a path for electricity, heat. ... Attitudes to the question are changing albeit slowly. 10. to chime with - to change slightly, esp. to make right or make suitable for a particular purpose or situation. ...

Еще в разделе: (Показать все результаты (>22) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/The_Day_The_World_Changed_article_and_vocabulary.pdf
• http://www.eng.math.msu.su/download/section_1.pdf

Клуб выпускников МГУ (Московский Государственный Университет) . В США выручка от продажи медицинской марихуаны достигла рекордных объемов, сообщает MSNBC. ... Аналитики прогнозируют, что марихуана может потеснить на рынке "Виагру", которая сейчас является самым прибыльным лекарством. По оценкам специалистов компании, объем продаж медицинской марихуаны в 15 американских штатах, где разрешено ее применение, удвоится в ближайшие пять лет. ...

Еще в разделе: (Показать все результаты (>213) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: IN VITRO ВЛИЯНИЕ ОПЕРАТОРА ЦИГУН НА ИЗМЕНЕНИЕ
• Клуб выпускников МГУ: Короткий путь к вершине: эволюция карьеры СЕО
• Клуб выпускников МГУ: Ученые обнаружили генетические корни интеллектуального

... Name of since: Population ecology of birds. ... Purpose of cooperation : Monitoring and ecological and physiological investigations of natural populations of model nest-hole breeding species in various localities of the range Ссылки на публикации / Reference to publications: http ://vertebrata.bio.msu.ru/html/ilyina_rus.html http ://vertebrata.bio.msu.ru/html/ilyina_eng.html Контакты: Керимов Анвар Бурханович, кафедра зоологии позвоночных биологического факультета ...

Еще в разделе: (Показать все результаты (>38) - www.msu.ru/ )

• http://www.msu.ru/work/2008/seminars.doc
• http://www.msu.ru/int/newpr/bio/genetics.doc
• http://www.msu.ru/work/GS_15.pdf

... Data . ... Planetary perturbations during geomagnetic storms are measured by the Dst index, which is the deviation of variation of the magnetic field from the undisturbed level, averaged over the values measured at the control chain of magnetic stations located in the low latitudes. ... To predict the hourly values of the Dst index, artificial neural networks (ANN) of perceptron type are used. ... Loading of the data on the values of the Dst index and forecast update are performed twice per hour. ...

Еще в разделе: (Показать все результаты (>3) - swx.sinp.msu.ru/ )

• SWX - Анализ