. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Apr-03 18:31:17 . 5.7K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 93.6K . application/octet-stream . Manifest . 2016-Apr-03 18:31:17 . 2.6K . application/octet-stream . evolution-3.18.5.1.ebuild . 2016-Mar-07 11:06:56 . 4.1K . text/plain . evolution-3.18.5.2.ebuild . 2016-Apr-03 15:39:49 . 4.1K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.9K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>16410) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/gnome-extra/evolution-data-server/
• Index of /pub/gentoo-portage/sec-policy/selinux-evolution/
• Index of /pub/gentoo-portage/gnome-extra/evolution-ews/

... In the region of ferroelectric phase transition of Rb 2 ZnCl 4 crystals, the relaxation of incommensurate (soliton) structure (IS) transferred abruptly to a nonequilibrium state with uniaxial mechanical stress G has been studied. The evolution of IS was recorded by recording changes in the dielectric constant E along the Y axis. ... As a result the E, t-curves corresponding to different initial states intersect and further they follow again the time logarithmic law. ...

Еще в разделе: (Показать все результаты (>75) - scon155.phys.msu.su/ )

• Научные публикации кафедры полупроводников за 2015 год
• Научные публикации кафедры полупроводников МГУ за 2012 год
• Научные публикации кафедры полупроводников за 2014 год

... The aim of the journal is the on-line publication of original papers in the field of numerical mathematics and its applications (for more details, see the scope of the journal). ... methods and algorithms of numerical mathematics and its applications for solving problems in science and technology; . ... Papers that deal with the development of new numerical methods and algorithms for solving problems of numerical mathematics and its applications correspond to the first subject area of the journal. ...

Еще в разделе: (Показать все результаты (>90) - num-meth.srcc.msu.ru/ )

• "Mathematical modeling of the 3D evolution problem for the interface between
• "The Fortran programming language evolution (1957-2007) and the prospects of
• "Modeling of magnetorotational instability evolution using a parallel RKDG

... Hittite-Luvian Bilingualism and the Origin of Anatolian Hieroglyphs' . ... Journal of Ancient Near Eastern Religions 5 (2005): 107-37. ... Wiesbaden: Harassowitz, 2005, pp. ... Moscow: Languages of Slavonic Culture, 2002, pp 93-116. ... Proceedings of the Nineteenth Annual UCLA IE conference (ed. K. Jones-Bley et al.) Washington, DC: Institute for the Study of Man, 2008, pp. ... Proceedings of the Seventeenth Annual UCLA IE conference , Los-Angeles, October 27-28, 2005 (ed. K. Jones-Bley et al.) ...

Еще в разделе: (Показать все результаты (>24) - imk.msu.ru/ )

• Vyach. Vs. Ivanov. Institute of World Culture

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>631) - kodomo.cmm.msu.ru/ )

• Practice1(evolution)
• Evolution model
• Possible gene's evolution

... Dmitry . ... V.V. Musatova, D.V. Bagrov, I.I. Agapov, I.V. Yaminsky, V.G. Bogush, К.V. Shaitan Study of nanofibers formed by engineered spider silk protein 1F9 by atomic force microscopy // Third international conference 'Modern achievements of bionanoscopy' (Moscow, 2009), Book of abstracts, p. 38-39. Y.М. Efremov, D.V. Bagrov, I.V. Yaminsky Condensation of water on mica surface // Third international conference 'Modern achievements of bionanoscopy' (Moscow, 2009), Book of abstracts, p. 28. ...

Еще в разделе: (Показать все результаты (>65) - www.spm.genebee.msu.ru/ )

• Alexander S. Filonov Professional Publications
• Статьи
• FemtoScan Online program

... Along with the stable inner proton belt, temporal variations of the 1-15 MeV protons at L=2.5-3.5 have been reported, with intensity increases and decreases registered during and after strong magnetic storms. ... Our study presents experimental evidences that creation and destruction of solar proton belts in the inner magnetosphere may be produced by the fast shifts of the proton penetration boundary without additional acceleration and injection. ... Black line shows the 50-90 MeV proton profiles. ...

Еще в разделе: (Показать все результаты (>120) - www.kosmofizika.ru/ )

... Cultural Mediation of National History and Identity . ... Second International Conference in Tampere , Finland . ... This sense of national identity, of history and possible futures, is communicated by cultural and institutional forces and integrated, individually and collectively, into our sense of a common shared nationhood. ... Through a semiological analysis of television texts, it is demonstrated how, by a re-interpretation of Russian history, new cultural and national identities are...

Еще в разделе: (Показать все результаты (>28) - psyberlink.flogiston.ru/ )

• Социальная психология

... Registration and Abstract submission are open for the International Conference on Physics Education ICPE 2014 , that will take place at the Sheraton Cordoba Hotel & Convention Center, C rdoba, Argentina, on August 18th to 22th, 2014. ... Keynote Speaker: Cedric Linder , Professor of Physics Education Research, Division of Physics Education Research, Department of Physics and Astronomy, Uppsala University, Sweden. ... Prof. Zulma Gangoso (Chair) . ... Prof. Zulma Gangoso (Argentina) . ...

Еще в разделе: (Показать все результаты (>34) - foroff.phys.msu.ru/ )

• International Collaboration
• Президиум УМС по физике

яЛП .

Еще в разделе: (Показать все результаты (>17) - lcc.chem.msu.ru/ )

• People

... S. V. Kolesnikov, A. L. Klavsyuk, A. M. Saletsky Strain relief and Pd island shape evolution on the palladium and palladium hydride (100) surface , Journal of Experimental and Theoretical Physics, 114, 994-1000 (2012). ... A.L. Klavsyuk, S.V. Kolesnikov, A.M. Saletsky, Magnetism and self-organization of 3d metals nanostructures embedded into Cu(100), Proceedings of the Joint European Magnetic Symposia (JEMS 2012), Parma, Italy, (2012). ... 2012). ... Россия, (2012). ...

Еще в разделе: (Показать все результаты (>52) - genphys.phys.msu.su/ )

• Конференции
• Микромаг - сервер

Russian . Selected publications of V. Zakharov 2015 . Zakharov V.S., Perchuk A.L., Zavyalov S.P., Sineva T.A., Gerya T.V. Supercomputer Simulation of Continental Collisions in Precambrian: The Effect of Lithosphere Thickness // Moscow University Geology Bulletin. ... P. 77–83. doi: 10.3103/S014587521502012X. Paper (pdf) . ... Paper (pdf) . ... Summary in English . ... DOI: 10.3103/S014587521101011X. Paper (pdf) . ... Paper (pdf) Summary in English . ... Page design: ©V.Zakharov . ...

Еще в разделе: (Показать все результаты (>35) - dynamo.geol.msu.ru/ )

• ГИС Восточно-Европейской платформы

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Специалисты из King's College London впервые выделили в крови 22 молекулярных биомаркера старения. ... Один из этих метаболитов - С-гликозил триптофан (C-glyTrp) - оказался особенно важен для понимания механизмов, лежащих в основе старения, а его роль стала неожиданной для авторов исследования. ... One particular metabolite, C-glycosyl tryptophan (C-glyTrp), correlated strongly with age (beta = 0.03, SE = 0.001, P = 7.0 ...

Еще в разделе: (Показать все результаты (>1508) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: NL International: отзывы о современном питании
• Клуб выпускников МГУ: International Fellows Program
• Клуб выпускников МГУ: Senior International Fellows Program

... The students of the Faculty of Geography study territorial distribution and spatial development patterns of various natural phenomena as well as social and economic objects. ... The academic program includes courses with lectures, seminars, laboratory and field training in natural sciences and humanities which form 4 blocks: . ... In addition to the field stations of the Faculty, the students have an opportunity to have their field training in scientific institutions and different companies. ...

Еще в разделе: (Показать все результаты (>5) - www.eng.geogr.msu.ru/ )

• Administration
• Selenga-Baikal research
• Postgraduate study

... Conferences . ... International Conference "V Bredikhin Reading 2014", Zavolzhsk, Russia, May 12-16, 2014 (L.A. Egorova). 5th European Conference for Aeronautics and Space Sciences - EUCASS 2013, Munich, Germany, July 1-5, 2013 (V.I. Sakharov). International Conference "Near Earth Astronomy-2013", Agoy, Krasnodar region, Russia, October 7-11, 2013 (L.A. Egorova). ... International Meteor Conference 2012, La Palma Island, Canary, Spain, September 20-23, 2012 (L.A. Egorova). ...

Еще в разделе: (Показать все результаты (>8) - lab106.imec.msu.ru/ )

... Philosophical Transactions of the Royal Society (Biological Sciences) . ... Biochimica et Biophysica Acta (Elsevier Science) . ... Discrete and Continuous Dynamical Systems, Series B (American Institute of Mathematical Sciences) . ... Physics in Medicine and Biology (Institute of Physics) . ... Mathematical Medicine and Biology: A Journal of the IMA . Mathematical Medicine and Biology will publish original articles with a significant mathematical content addressing topics in medicine and biology. ...

117. http://www.mce.biophys.msu.ru/files/mce14eng.pdf

118. Международный Университет Междисциплинарных Знаний - Главная

119. Государственное управление. Электронный вестник

120. Кривоножко Владимир Егорович | Кафедра НДСиПУ