... B Measurements of variation of electric charge on a prototype of fused silica test mass for gravitational wave antenna . ... G The \optical lever" intra-cavity readout scheme for gravitational-wave antennae . ... B. Measurements of variation of electric charge on a prototype of fused silica test mass for gravitational wave antenna Variations of electric charge located on fused silica mirror can produce uctuating force and correspondingly excess noise in the interferometric gravitational wave...

Еще в разделе: (Показать все результаты (>119) - hbar.phys.msu.ru/ )

• The Work of Velikovsky
• Historical Eclipses
• R. R. Newton, "Two uses of ancient astronomy"

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>5) - www.sciencepark.ru/ )

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>43) - cosmos.msu.ru/ )

• UNIVERSAT-2009: University Satellites in Space Sciences Education, Zvenigorod,
• Space Scientific and Education project of Lomonosov Moscow State University

... 1066 , , , . ... Origin of the English language (parent language, family tree, cognates) Practical application of knowledge in the field of language history. ... Changes in: - Grammar - Vocabulary General (stages of development) - Spelling - Phonetic systems 8. Periods of the English language historical development. ... English Alphabet: changes and development from Old English to Modern English. ... Cambridge University Press, 2003. ... Oxford University Press, 2001. the English language. ...

Еще в разделе: (Показать все результаты (>71) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/future-students/lingua-4-teens/tezis-filosof.pdf

RADIO EMISSION OF THE MOON BEFORE AND AFTER THE LUNAR PROSPECTOR IMPACT Berezhnoi A.A.*, Gusev S.G.**, Khavroshkin O.B.***, Poperechenko B.A.**, Shevchenko V.V.*, Tzyplakov V.A.*** * Sternberg Astronomical Institute, Universitetskij pr., ... For the registration of lunar RSR after the Lunar Prospector impact radio observations of the Moon on the two 64-m radio telescopes of the SDO MEI at Medvezh'i Ozera and Kaliazin were conducted during July 30 - August 2, 1999. ...

Еще в разделе: (Показать все результаты (>66) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Shev/Publications/ms38/ms082.pdf
• http://selena.sai.msu.ru/Bus/Publications/m44_14_busarev_etal.pdf
• http://selena.sai.msu.ru/Pug/Publications/Pugacheva%20LPS%2041.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Optical Zoomeron as a Result of Beatings of the Internal Modes of a Bragg Soliton B. I. Mantsyzov Faculty of Physics, Moscow State University, Vorob'evy gory, Moscow, 119992 Russia e-mail: mants@genphys.phys.msu.ru Received June 22, 2005; in final form, July 12, 2005 A new solution of two-wave MaxwellнBloch equations has been obtained analytically and numerically. ... The absence of losses on the emission of continuous spectrum waves indicates that the solutions found for the internal mode are...

Еще в разделе: (Показать все результаты (>42) - genphys.phys.msu.su/ )

• http://genphys.phys.msu.su/rus/sci/photonics/PDF/6.pdf
• http://genphys.phys.msu.su/rus/sci/photonics/PDF/JETP56.pdf
• http://genphys.phys.msu.su/rus/lab/mol/234/_private/_vti_cnf/binom.htm

Twilight observations with MASS/DIMM B. Safonov Sternberg Astronomical Institute Moscow State University Comprehensive Characterization of Astronomical Sites, 2010 B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 1 / 17 Why observe in twilight with MASS/DIMM? ... ASM includes 3 devices sensitive to background: guider, DIMM and MASS. B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 2 / 17 Background in guider. ...

Еще в разделе: (Показать все результаты (>16) - site2010.sai.msu.ru/ )

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>18) - npidb.belozersky.msu.ru/ )

• Index of /data/to_be_deleted
• NPIDB: List of complexes

... Data . ... Planetary perturbations during geomagnetic storms are measured by the Dst index, which is the deviation of variation of the magnetic field from the undisturbed level, averaged over the values measured at the control chain of magnetic stations located in the low latitudes. ... To predict the hourly values of the Dst index, artificial neural networks (ANN) of perceptron type are used. ... Loading of the data on the values of the Dst index and forecast update are performed twice per hour. ...

Еще в разделе: (Показать все результаты (>7) - swx.sinp.msu.ru/ )

. Last changed: 22.05.02 .

Еще в разделе: (Показать все результаты (>51) - old.philol.msu.ru/ )

• Large transportation networks with finite-dimensional state space. Asimptotic
• MSU-LGCLL:: Anatoliy A. Polikarpov - Some Factors and Regularities of
• MSU-LGCLL:: Anatoliy A. Polikarpov - Major Tendences in Micro- and

... Conference Venue . ... Latest achievements in the field of humic substances and natural organic matter (NOM) research . Theory and practice of a directed use of humic substances and other biologically active compounds in crop production and animal feed . ... Organic farming and ecoadaptive agriculture: the role of humic substances and other biologically active compounds . ... The school on isolation of humic substances (HS) using solid phase extraction (SPE) cartridges . ...

Еще в разделе: (Показать все результаты (>85) - mgumus.chem.msu.ru/ )

... Doronina L. , Volodin I., Volodina E. The arousal-related shifts in call characteristics of the defeated great gerbils Rhombomys opimus // 6th International Zoo and Wildlife Research Conference on Behaviour, Physiology and Genetics, Berlin, IZW, 2007, p. 77. ... Sibling aggression in lynx: traits and consequences // Advances in Ethology 38, Supplements to Ethology. ... Advances in Ethology, Contributions to the 5-th International Symposium on Physiology, Behaviour and Conservation of Wildlife. ...

Еще в разделе: (Показать все результаты (>41) - vertebrata.bio.msu.ru/ )

• Courses
• Выступления студентов и аспирантов на конференциях

... March, 2005 . ... Moscow State University Russian Language Centre . Moscow State University . ... Learn Russian at the Moscow State University! The Official MGU Hymn . ... MGU Russian Language Centre changed the prices for special offers and distance training web-page is coming soon. ... About 360 guests, among them the descendants of the noble families which are well known in Russia' history, gathered at prestigious London hotel Dorchester. (more.. ... download our flash movie about MGU . ...

Еще в разделе: (Показать все результаты (>4) - www.rlcentre.com/ )

Here's a little better image of SN 1998s from last night (98 Mar. ... I went crazy last night trying to get an image of the new SN without a lot of scattered (the streak of light above the galaxy) light from Chi UMa which is close by. I'm going to change a few things in my camera/reducer setup an try again on the next clear night. I'll send you a better image then. ... Back to Supernovae in NGC and IC galaxies . Back to Supernova 1998S images . ...

Еще в разделе: (Показать все результаты (>20) - www.rochesterastronomy.org/ )

• Supernova 1998T in NGC 3690
• Supernova 2000H in IC 454
• Supernova 2003aa in NGC 3367