... Географии мирового хозяйства . ... Выберите кафедру . ... Кафедры . ... География" . ... Учебно-методический отдел . ... Mikhailov V.N. Theoretical bases of forecasting the response of river deltas to the sea level rise. ... Kravtsova V.I. Distribution of thermokarst lakes in Russia. ... The exception is for the soils of steep stony slopes showing lower humus content and decreased pH values because of more intensive soil washing and for peat soils where part of organic matter simply burns off. ...

Еще в разделе: (Показать все результаты (>249) - www.geogr.msu.ru/ )

• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,
• CONTENT 1 (4) 2011
• CONTENTS ?6 - 2011

Шаблон сетки . Grid stencil . Шаг винта . ... Шаг наискорейшего спуска . The steepest descent step . Шаг по времени . The time step is chosen according to the Courant stability criterion . Шаг распределения . Distribution step . Шаг сетки . Grid spacing . Grid step . Шаг сетки по направлению . ... Шаг спуска . Descent step . ... Small ball . ... Spherical cavity . ... Schoenberg, Sch?nberg . ... Ширина ленты . Bandwidth . ... Schl\"omilch . ...

Еще в разделе: (Показать все результаты (>40) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/16.htm
• Параллельные программы. ЛИТЕРАТУРА

PTOLEMY'S FAILINGS . ... The Crime of Claudius Ptolemy. ... Almost as a stocktaking of Ptolemy , the 1970s saw the publication of three monographic writings on his astronomy , viz, O. Neugebauer's authoritative account of the contents of the Almagest in its context of the mathematical side of the rest of ancient astronomy , 1 O. Pedersen's Almagest companion volume designed to guide also the student of Latin astronomy up to the Renaissance, 2 and R. R. Newton's ...

Еще в разделе: (Показать все результаты (>84) - hbar.phys.msu.ru/ )

• The jump of the second derivative of the moon's elongation
• Ответ Wally на книгу "Крах С14"

... The problem of behavior of lower layer of the Earth crust in the process of continental subduction was studied basing on conception of two-staged plate tectonic. ... The dynamic of the change of the crust thickness in the orogens in 20 m.y. time in obtained, which corresponds to the real collision time. ... FRACTAL ANALYSIS AND SEARCHING FOR DETERMINISM IN EEG DATA. ... Our analysis show that time series of seismic energy have fractal properties in a range more than one order on frequency. ...

Еще в разделе: (Показать все результаты (>21) - dynamo.geol.msu.ru/ )

• Publications of V.Zakharov

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf

... UHECR SINP MSU . ... News . ... TUS Ultra high energy cosmic ray detector on-board the Lomonosov satellite . ... According to existing estimations it can be a prominent source of ultra high energy cosmic rays (UHECR). ... In either case, the newly born magnetar is an attractive site for producing ultrahigh-energy cosmic rays (particles with individual energies exceeding 10 18 e V ; UHECRs). ... A new mechanism for the acceleration of ultra high energy cosmic rays (UHECR) is presented here. ...

Еще в разделе: (Показать все результаты (>9) - uhecr.sinp.msu.ru/ )

• Новости КЛПВЭ

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... The derivative was obtained for monomer : CHP ratio of 100 mg per 1 g and marked as HQ-100. ... It was established that the sequestration of Np at low pH values upon interaction with quinone enriched HA was observed only in case of goethite colloids and not in case of hematite colloids. 1,0 0,9 0,8 1,0 2.7 9.6 0,9 0,8 8.4 7.9 7.2 6.7 5.7 5.1 c(Np) total = 5.8*10 M c( CHP ) total = 44 ppm c (-FeOOH) = 0.22 g/l -7 Np sorb / Np total 0,7 0,6 0,5 0,4 0,3 0,2 0,1 0,0 0,0 0,1 Np sorb / Np...

Еще в разделе: (Показать все результаты (>121) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2009/2009-kulikova-uptake.pdf
• Instructions for book-contributors

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt

... О кафедре . ... Сотрудники . ... Соколов Дмитрий Дмитриевич, родился в 1949 г., поступил на Физфак МГУ в 1966 г., с 1972 г. - на кафедре математики, сначала аспирант, а потом, постепенно, стал профессором, доктором физ.-мат. наук. ... Magnetic fields as a unique tracer of shearing gas flow in a barred galaxy", Beck R., Ehle M., Shoutenkov V., Shukurov A., Sokoloff D., Nature, 397, (1999), 324. ... Семинар кафедры . ... Кафедра математики физического факультета МГУ им. М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>2) - matematika.phys.msu.ru/ )

30 TH I NT E R N AT I ON AL C OSMIC R AY C O N F ER EN C E Search for global asymmetry of UHECR arrival directions with the TUS space detector P. K LI M OV 1 ,O. K AL ASHE V 2 , B . ... Introduction Space-based ultra-high-energy cosmic-ray detectors such as TUS or JEM/EUSO are best suited for searches of the global anisotropies in the distribution of arrival directions of cosmic-ray particles because they provide full-sky coverage with a single experiment. ... Phys. 12, 25 (1999). ... Phys. Lett. ...

Еще в разделе: (Показать все результаты (>3) - cosrad.sinp.msu.ru/ )

... Summury: Usually a water column consists of two big layers. The upper layer (10-50 m deep) is characterized by strong mixing, as a result, both the biomass and nutrients are nearly uniformly distributed there. ... In this article we show that in the presence of an upper mixed layer (UML) there can be two stable vertical distributions of phytoplankton biomass: either the bulk of the biomass is located within the upper layer or below it. ...

Еще в разделе: (Показать все результаты (>68) - chaos.phys.msu.ru/ )

• Alexey Ryabov. Research

Electron and proton impact ionization of atoms and molecules . Theory of few-body Coulomb scattering This is one of the major topics in the research activity of our laboratory. ... Electron momentum spectroscopy (EMS) EMS is the (e,2e) method involving high incident energy and large momentum transfer. ... We develop a theory of the single- and double-ionization EMS processes in atomic and molecular systems. ... c) Laboratory of mathematical models of quantum scattering processes, 2012 . ...

Еще в разделе: (Показать все результаты (>10) - lmmqsp.sinp.msu.ru/ )

. РУС / ENG . Division of Applied Mathematics, . Faculty of Physics, MSU . Main Division structure Research work PhD study Graduate Undergraduate Work with students Archive Enter . Work with students . Conferences . Conference "From atom to galaxy" . Training Courses . ї Department of Mathematics, Faculty of Physics, Lomonosov MSU 2014-2016.

115. http://danp.sinp.msu.ru/LIIWM/PhysRevA56_1997_2848NMKab.pdf

116. http://ofvp.phys.msu.ru/upload/iblock/d1a/2010%20apb%20silaeva.pdf

117. http://cellmotility.genebee.msu.ru/html/articles/alieva2000.pdf

118. http://www.genebee.msu.ru/services/papers/BIOSYS_30/BIOSYST.DOC

119. Download Yuri Shvarov's files

120. http://tex.bog.msu.ru/texdisk.html