International Laser Center of MSU . ... Education . ... 06.10.2014 . October 10, 2014 . 15:00 S.A. Akhmanov Hall, KNO . ... 20.09.2009 . ... 15:00 S.A. Akhmanov Hall, Nonlinear Optics Bld. ... In our work we have obtained analytical expressions, which describe the distributions of intensity and polarization in the cross-section of a second-harmonic (SH) light beam. It is found that the polarization state drastically changes along the cross-section of the signal light beam. ...

Еще в разделе: (Показать все результаты (>55) - ilc.phys.msu.ru/ )

• Публикация
• Grant detail

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>163) - www.pereplet.ru/ )

... Earlier still lies the remaining frontier, where the first stars, galaxies and massive black holes formed. ... Building on this general framework, and relying on the development of efficient new computational tools, the fragmentation properties of primordial gas inside such minihaloes were investigated with numerical simulations, leading to the result that the first stars, so-called population III, were predominantly very massive4,8 (see Box 1 for the terminology used here). ... Astrophys. ... III. ...

Еще в разделе: (Показать все результаты (>53) - ocean.phys.msu.ru/ )

• Index of /courses/geo/lectures-addons/02/
• Index of /courses/geo/lib/books/Brown x26; Mussett The Inaccessible Earth/
• Index of /courses/geo/lectures-addons-11/

Paleosoils: Indicators of Environmental Changes in the Holocene . ... According to Dokuchaev V.V. "the soil is the mirror of landscape". The dependence between soil formation processes and climatic changes (thermal conditions, humidity) has been established. ... The experience gained on studying buried soils of Russia and the CIS countries in the Holocene shows that paleoclimatic conditions can be reconstructed by buried soils for various the Holocene chronocuts rather accurately. ...

Еще в разделе: (Показать все результаты (>127) - www.fadr.msu.ru/ )

• An International Consensus on Calcareous Paleosol Classification
• NEW FARM RESOLUTION (From RUSAG conference)
• Abstracts of Paleopedology Symposium and Poster Session at XY INQUA Congress in

Positioning of Nucleosomes at DNA Containing Short Periodic Sequences A.P Lifanov1,3, V.J. Makeev1,2, N.G. Esipova 1 2 1 V.A. Engelhardt Institute of Molecular Biology, Moscow, Russia Vavilov Institute of General Genetics, Moscow, Russia 3 johnnie_me@list.ru Nucleosome distribution, alongside with histone modifications and RNA polymerase II (Pol II) occupancy shows preferential association with exons ( ... Histogram of relative positions of nucleosome and exon borders is shown in Fig. ...

Еще в разделе: (Показать все результаты (>225) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/115.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/14.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/158.pdf

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>4) - physcontrol.phys.msu.ru/ )

• List All Categories

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>17) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... A Primer from the Reform of Personal Income Taxation in Russia Introduction. ... However, to use the welfare function one needs to aggregate individual preferences that can also be unknown. ... The derivations lead to the conclusion that the optimal marginal income tax rate is increasing as the elasticity of labor supply increases. ... In this paper we obtain the characteristics of the labor supply for different population groups to get the elasticities of labor supply with respect to a post tax...

Еще в разделе: (Показать все результаты (>7) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

Wavelet Analysis of E852 Experimental Data V. L. Korotkikh  and L. I. Sarycheva   Scobeltsyn Institute of Nuclear Physics, Moscow State University, Moscou 119899, Russia Abstract. A calculation of background in the hp 0 mass spectrum by the wavelet analysis is presented. ... A large final state statistics of E852 experiment [4, 5, 6] in the p p interactions at 18 GeV/c allows to use the wavelet analysis both for one­dimensional and for two­ dimensional distributions. ... are built (fig. ...

Еще в разделе: (Показать все результаты (>48) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/~vlk/g276799p10_proof.pdf

. Fig. 3. Dependence of km on surface irradiance I(0). Solid and dashed lines shows km value averaged over 23 stations the Baltic Sea and band of standard deviation accordingly. Designations: 1 - km > 7*10 -5 ; 2 - km < 7*10 -5 . Fig. 4. The dependence of I 1/2 m on the average chlorophyll a content in water column and polynomial regression of this dependence (A). Histogram of distribution of the ratio of I 1/2 m to results of polynomial regression (B).

Еще в разделе: (Показать все результаты (>16) - www.biophys.msu.ru/ )

• Как отмечалось выше, обилие (по Fo) и фотосинтетическая активность

Шаблон сетки . Grid stencil . Шаг винта . ... Шаг наискорейшего спуска . The steepest descent step . Шаг по времени . The time step is chosen according to the Courant stability criterion . Шаг распределения . Distribution step . Шаг сетки . Grid spacing . Grid step . Шаг сетки по направлению . ... Шаг спуска . Descent step . ... Small ball . ... Spherical cavity . ... Schoenberg, Sch?nberg . ... Ширина ленты . Bandwidth . ... Schl\"omilch . ...

Еще в разделе: (Показать все результаты (>49) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/16.htm
• Параллельные программы. ЛИТЕРАТУРА

... 3D magnetosphere . ... Data . ... Magnetosphere . ... Magnetic field at the selected point Module of the Magnetic field distribution along Sun-Earth line Noon-Midnight magnetosphere structure . ... Point coordinates, where magnetic field will be calculated: . ... Magnetic field at MD outer edge . ... Magnetic field at TC inner edge . ... Distance to external edge of MD . ... Distance to inner edge of MD . ... Magnetopause stand-off distance . ... Distance to inner edge of geotail current sheet . ...

Еще в разделе: (Показать все результаты (>1224) - swx.sinp.msu.ru/ )

• Index of /models/temp
• Index of /models/database/db/000912
• Index of /models/database/db/010128

... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ‘GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY’ aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>249) - www.geogr.msu.ru/ )

• CONTENTS ?3 - 2009
• CONTENTS ? 4 - 2013
• CONTENT 1 (4) 2011

... О кафедре . ... Сотрудники . ... Соколов Дмитрий Дмитриевич, родился в 1949 г., поступил на Физфак МГУ в 1966 г., с 1972 г. - на кафедре математики, сначала аспирант, а потом, постепенно, стал профессором, доктором физ.-мат. наук. ... Magnetic fields as a unique tracer of shearing gas flow in a barred galaxy", Beck R., Ehle M., Shoutenkov V., Shukurov A., Sokoloff D., Nature, 397, (1999), 324. ... Семинар кафедры . ... Кафедра математики физического факультета МГУ им. М.В. Ломоносова . ...

Еще в разделе: (Показать все результаты (>2) - matematika.phys.msu.ru/ )

Marketing Plan Outline Canada Business Service Centres - CBSCs Last Verified: 2004-11-08 Document No. 4014 Summary A marketing plan is designed to direct company activities towards the satisfaction of customer needs; determine what the customer wants, develop a product/service to meet those needs, get the product/service to the end user and communicate with the customer - at a profit! ... levels, sales volumes? ... What is the consumer acceptance price range for this type of product/service? ...

Еще в разделе: (Показать все результаты (>15) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/guidetomarketresearch.doc

Curriculum vitae Petr V. Paramonov Professor of Moscow State University 22 2011 . Surname: Paramonov Name: Petr Patronymic Vladimirovich Degrees: Candidate Phys.-Math. ... 1994: Submission and defence of doctoral dissertation "On conditions for approximability of functions by solutions of elliptic equations"(Steklov Institute of Mathematics). ... Paramonov P.V. and S uniform algebras., ... I. Mat.- ... Paramonov P.V., Interrelation of local and global approximations by holomorphic functions., ...

Еще в разделе: (Показать все результаты (>46) - new.math.msu.su/ )

• http://new.math.msu.su/department/probab/bsk_19_3.html
• Andrei Vladimirovich Fursikov | Department: General Problems of Control.

Unfaithful embedding of causal sets arXiv:1006.2320v1 [physics.gen-ph] 10 Jun 2010 Alexey L. Krugly Abstract In the causal set approach, spacetime is a continuous approximation of a faithful emb edded causal set. But the faithful emb edded causal set describ es the empty spacetime and cannot describ e matter. ... If we describe the elements of the faithfully embedded causal set as the vertices of the graph, and segments of the timelike curves as edges these vertices must have an infinite valency. ...

Еще в разделе: (Показать все результаты (>19) - temporology.bio.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/krugly_an-example.pdf
• Уравнения динамики систем

... Summury: Usually a water column consists of two big layers. The upper layer (10-50 m deep) is characterized by strong mixing, as a result, both the biomass and nutrients are nearly uniformly distributed there. ... In this article we show that in the presence of an upper mixed layer (UML) there can be two stable vertical distributions of phytoplankton biomass: either the bulk of the biomass is located within the upper layer or below it. ...

Еще в разделе: (Показать все результаты (>69) - chaos.phys.msu.ru/ )

• Alexey Ryabov. Research

... GRACE for SUSY Processes QCD Event-Generators for LHC Summary 2 Introduction Automatic Calculation Systems It is 20 year Anniversary ! ... Phys.Rev.D75, 113002('07) 15 GRACE for SUSY : Gauge Fixing Non-linear Gauge Fixing : S-leptons GF-S = M. Jimbo, et al, [hep-ph/1006.3491] 16 GRACE for SUSY : Renomarization Electro-weak corrections On-Mass-Shell scheme mass shifts for h0, H±, 0 2,3,4 only Sfermion sector 17 GRACE for SUSY : Renomarization QCD corrections 18 GRACE for ...

Еще в разделе: (Показать все результаты (>137) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/GRACE.pdf
• http://qfthep.sinp.msu.ru/talks2015/1435513529_malyshev_Higgs.pdf
• http://qfthep.sinp.msu.ru/talks2011/sochi_melnikov.pdf