... ID 223240); published December 10, 2014 Resonant enhancement of second-harmonic generation (SHG) intensity from a thin metal film is demonstrated in a Tamm plasmon-polariton mode excited at a metal/photonic crystal interface using nonlinear spectroscopy. ... SHG enhancement factor evinces considerable angular dependence, rising from 50 for the 45° angle of incidence to 170 for the 10° angle of incidence. ... The angle of incidence is 20°. (b) Schematic of the SHG experiment. ...

Еще в разделе: (Показать все результаты (>71) - nanolab.phys.msu.ru/ )

• Our paper has been published in Journal of Magnetism and Magnetic Materials |
• labadmin's blog | Laboratory of Nanophotonics & Metamaterials
• labadmin's blog | Лаборатория нанооптики и метаматериалов

Mathematical Finance, Vol. ... September 1920 1922-1925 1925-1927 January 1926 1 October 1927 1937 1 October 1937 1941 28 April 1946 1996 Louis Jean-Baptiste Alphonse Bachelier is born in Le Havre Graduates from secondary school at Caen Father's death Mother's death Bachelier is the head of Bachelier fils Military service Student at Sorbonne Bachelor in sciences at Sorbonne Certificate in mathematical physics Bachelier defends his ... BACHELIER'S PUBLISHED WORKS Books 1. ...

Еще в разделе: (Показать все результаты (>58) - new.math.msu.su/ )

• Официальный сайт механико-математического факультета МГУ имени М.В.Ломоносова

... Namely, in the general case, we should identify a meter (subsequently referred to just as meter) with an essentially quantum object, which gives the result of measurement in the quantummechanical or classical form depending on its surroundings; this must be reflected in the specific form of the transformation which is actually performed in the object­meter system. ... A of the object with the help of a set of orthogonal (i.e., classically distinguishable) states |B of the meter, has the form = R ( |...

Еще в разделе: (Показать все результаты (>78) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/PRA22309.pdf
• http://qilab.phys.msu.ru/papers/LPL-FM-2006.pdf
• http://qilab.phys.msu.ru/papers/Laser-Phys-Lett-2004.pdf

... Начало www.99ru.ru Страны и континенты Балканы 1159 . ... Введите код товара из каталога. автор PRIJATELJ, KRUNO . Хорватия Dalmatian Painting of the 14th to the 20th centuries . ... Summary: In the project "Selected questions of Dalmatian painting of the 14th to the 20th centuries" research was carried out on numerous not studied or not enough examined questions of the history of painting in Dalmatia in the cited course of time. The paintings from the 14th century were the oldest studied. ...

Еще в разделе: (Показать все результаты (>42) - www.bukivedi.ru/ )

... You buy Gucci shades from the company store in the us. There are a total of 7 Gucci stores in different metropolitan areas like Honolulu, Hawaii, Boston. Or if you?re planning an overseas trip to Europe and then sure you visit part of the Gucci retail stores. One can find the brand stores in Florence, . ... These stores offer complete and original associated with designer Gucci Sunglasses and associated accents. ... One should be careful not purchaser gucci Fake. ... 2016 С Днем Победы! ...

Еще в разделе: (Показать все результаты (>130) - elana.sinp.msu.ru/ )

• Наши ветераны | С Днем Победы!
• editor | С Днем Победы!
• cheap moncler developed by examiners through their skills and expertise | С

... Выпускники . Выпускники ВМиК . ... Женский клуб . ... Издательство МГУ . ... Новости для выпускников . МГУ им.Ломоносова . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Создан метод, позволяющий определить возраст человека по его слюне . ... Генетики из Университета Калифорнии нашли способ определять возраст человека. ... Их новый метод тестирования способен перевернуть криминалистику и помочь определять точно возраст преступника, констатируют эксперты. ... Self-conscious about your age? ...

Еще в разделе: (Показать все результаты (>388) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Три тысячи продуктов для продления молодости
• Клуб выпускников МГУ: Таблетки замедляющие процесс старения уже в продаже.
• Клуб выпускников МГУ: Революция в медицине: открыт простой способ получения

... Interface description . ... 6 Distributed array creating and deleting . ... 13.4 Access to elements of local part of distributed array . 13.4.1 Requesting if array element is allocated in local part of distributed array . ... 13.4.5 Coping element of local part of distributed array to element of local part of other distributed array . 13.4.6 Requesting address of element of local part of distributed array . ... 14.5 Access to distributed array elements, allocated in remote element buffer . ...

Еще в разделе: (Показать все результаты (>121) - sp.cs.msu.ru/ )

• DVM debugger. Detailed design. Part 4
• DVM-system. Installation guide. Version 3.30
• Fabrik - A Visual Programming Environment

... A p P EC Astropar ticle Physics for Europe · Cosmic rays: A large array for the detection of charged cosmic rays ( Auger North) · Gamma rays: A large array of Cherenkov Telescopes for detection of cosmic high energy gamma-rays ( CTA ) · High energy neutrinos: A cubic kilometre-scale neutrino telescope in the Mediterranean (KM3NeT) · Dark matter search: Ton-scale detectors ... A p P EC Astropar ticle Physics for Europe · Cosmic rays: ­ ­ ­ ­ ­ AMS detector launched. ...

Еще в разделе: (Показать все результаты (>4) - tunka.sinp.msu.ru/ )

Figure 1: The fit results of MDPWA (curves) and (PWA+MDF) (crosses) of jъ \Gamma sys­ tem: a) P+ , b) D+ intensities and c) their relative phase \Delta(P + \Gamma D+ ). Fig.1a shows also the contributions of 1 \Gamma+ signal intensity (1), the sum of the leakage and (signal ­ leakage) interference term (2) and the whole sum (3). The fitted leakage contribution is equal to ffl (leak=D+ ) = 0:018 at OE (leak) = 80 o . 6

Еще в разделе: (Показать все результаты (>61) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/~vlk/g276799p10_proof.pdf
• http://lav01.sinp.msu.ru/~igor/seminar/Porteboeuf-Houssais_AFTER_Mai2012_AMPT.pdf
• http://lav01.sinp.msu.ru/~vlk/report97_monet.ps

... Bachelor of Science in Physics - Georgetown University, Washington DC, United States. Bachelor of Science in Foreign Service - Georgetown University, Washington DC, United States. ... The work is carried out at the United States Naval Observatory in Washington. Development of the multi-channel Fourier Transform Spectrometer for the United States Naval Observatory. ... Judo and Sambo : . ... Currently training in Sambo-70 (Moscow) and Washington Judo Squad (Washington) ...

Еще в разделе: (Показать все результаты (>62) - www.spm.genebee.msu.ru/ )

... For the past years I have been working on the problem of synthesis of light curves of close binary systems, consisting of a normal star and a compact object (point object with fixed X-ray luminosity). ... Possible existence of a bright spot on the disk's lateral surface is taken into account. ... The last of then will be published in Gordon and Breach Publishers ( Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ... Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ...

Еще в разделе: (Показать все результаты (>15) - uranus.sai.msu.ru/ )

... Division of General Nuclear Physics MSU . ... INP MSU . ... Faculty of Physics MSU . ... The ANTARES project is the largest project on registration astrophysical neutrino by detection of cherenkov radiation from secondary particles, arising by neutrino interaction with substance of the Earth. ... Since June, 2009 the group of the Lomonosov Moscow State University takes part in the project. ... Our group consists of young researchers of MSU Skobeltsyn Nuclear Physics Institute and Faculty of Physics....

Еще в разделе: (Показать все результаты (>23) - antares.sinp.msu.ru/ )

• ANTARES в МГУ

ON THE ORIGIN OF THE KAIDUN CR2 CHONDRITE GLASSES Kashkarov L.L., Kalinina G.V., Skripnik A.Ya. ... In given work the results of structural, petrology-chemical and track researches of glass fragments of a meteorite Kaidun are presented: On the basis of the received data the possible processes of origin of these glasses at an early stage of formation of a meteorite parent body are considered. ... The glass samples were preferentially out of crushed Kaidun meteorite. ... Nuclear Tracks in Solids. ...

Еще в разделе: (Показать все результаты (>1115) - geo.web.ru/ )

• Закономерности распределения воды в приповерхностном грунте Марса,
• The influence of boundary layer effects on the melt inclusions compositions.
• Calendar Converter

... UHECR SINP MSU . ... News . ... TUS Ultra high energy cosmic ray detector on-board the Lomonosov satellite . ... According to existing estimations it can be a prominent source of ultra high energy cosmic rays (UHECR). ... In either case, the newly born magnetar is an attractive site for producing ultrahigh-energy cosmic rays (particles with individual energies exceeding 10 18 e V ; UHECRs). ... A new mechanism for the acceleration of ultra high energy cosmic rays (UHECR) is presented here. ...

Еще в разделе: (Показать все результаты (>3) - uhecr.sinp.msu.ru/ )

• Новости КЛПВЭ

... Recently Professor Bagotsky summarized his uniquely long scientific work in a brief article "Fuel Cells, Batteries, and the Development of Electrochemistry" published in the "Electrochemistry ­ Past, Present, and Future" issue of J. Solid State Electrochemistry(Vol.15,p.1559,2011).Hementionedthatbecause he was working simultaneously in the fields of fundamental and applied electrochemistry, he had the opportunity to experience the mutual influence in the development of these two fields. ...

Еще в разделе: (Показать все результаты (>69) - electr003.chem.msu.ru/ )

• Academician Aleksandr Naumovich Frumkin
• Boris B. Damaskin
• Vladimir Sergeevich Bagotsky

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/insilicobiol_2003.pdf

... Entanglement is achieved by a coherent superposition of pairs emitted from two nonlinear crystals, with the polarization of the biphotons from the first crystal being changed by a transformer placed between the two crystals. ... The polarization of the biphotons generated on the first passage was rotated through 90° by a successive transformation: /4 plate­mirror­/4 plate. ... The plates made a polarization transformation of the states of the biphotons generated in the first crystal. ...

Еще в разделе: (Показать все результаты (>96) - qi.phys.msu.ru/ )

• http://qi.phys.msu.ru/kulik/Papers/Bell_interf.pdf
• http://qi.phys.msu.su/papers/2007-jetp(e)-104-736.pdf
• http://qi.phys.msu.ru/kulik/Papers/PRA32332.pdf

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>100) - monkey.belozersky.msu.ru/ )

• SCOP classification
• ETS numeration assumed
• Example of supporting positions