Mathematical Modeling of Complex Information Processing Systems 119 OPTIMAL CONTROL IN THE PROBLEM OF UNPACKING A SPACE TELESCOPE MIRROR V. V. Alexandrov 1 , D. I. Bugrov 1 , B. A. Khrenov 2 , S. S. Migunov 1 , and L. Gomez Esparza 3 The problem of optimal control in the processes of unpacking a space telescopeґdetector is considered. ... The coordinate system Oxyz associated rigidly with the segments is obtained by the rotation of the system Ox 1 y 1 z 1 about the axis Oz 1 by an angle '. ...

Еще в разделе: (Показать все результаты (>76) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/13.htm
• http://num-anal.srcc.msu.su/eng_math/redict/15.htm
• http://num-anal.srcc.msu.su/eng_math/redict/17.htm

... Kornev, V., Sharafiev, A., Kolotinskiy, N., and Mukhanov, O. Microwave dynamics of superconducting quantum cell.  ... DOI  ] . ... Kornev, V., Sharafiev, A., Soloviev, I., and Mukhanov, O. Signal and noise characteristics of bi-squid.  ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., Skripka, V., and Mukhanov, O. Superconducting quantum arrays.  ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., and Mukhanov, O. Superconducting quantum arrays for broadband rf systems.  ...

Еще в разделе: (Показать все результаты (>37) - cryolab.phys.msu.ru/ )

• Publications (from 2011)
• Publications (before 1991)
• Molecular single-electronics

... Parent Directory - 76.jpg 31-Mar-2002 13:00 5.9K 704.jpg 31-Mar-2002 12:41 4.8K 704_1.jpg 31-Mar-2002 12:40 4.8K 704_2.jpg 31-Mar-2002 13:04 5.6K 704_3.jpg 31-Mar-2002 13:05 5.3K 758.jpg 03-Apr-2002 21:01 5.1K 758_2.jpg 03-Apr-2002 21:00 4.8K 758_3.jpg 03-Apr-2002 21:08 5.1K 758_4.jpg 31-Mar-2002 13:30 6.8K 758_5.jpg 03-Apr-2002 21:09 4.4K 758_6.jpg 31-Mar-2002 13:32 6.1K 758_7.jpg ...

Еще в разделе: (Показать все результаты (>57) - sp.cs.msu.ru/ )

• Index of /images/neerc2001/small
• Index of /images/olymp2001/small
• Index of /images/zhogolev/small

... Director of the Institute of World Culture . Member of Russian Academy of Sciences . ... Moscow State Lomonosov University (MGU); Institute of Slavic Studies of the Russian Academy of Sciences; Russian State Humanities University (RGGU); University of California, Los Angeles (UCLA), Department of Slavic Languages and Literatures and Indo-European Studies Program. ... Director of the Research Institute of World Culture of the Moscow Lomonosov State University (MGU), 1989-present. ...

Еще в разделе: (Показать все результаты (>17) - imk.msu.ru/ )

... 1998 1 : Defended the Doctorate Degree Thesis on "Models of Cosmic Ray Particle Fluxes (Development and Applications)". ... Space Weather . ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv. ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv.Space Res. ...

Еще в разделе: (Показать все результаты (>7) - srd.sinp.msu.ru/ )

... 6. 2 http :// lizard.phys.msu.su ї л? (лElizavet?) : (1) ( Roman ): , , , , , ; (2) ( Italic ): , , , , , (3) ( SMALL C APS): , , , , , ; ї л ? (лElizavet Narrow?) : (1) ( Roman ): , , , , , ; (2) ( Italic ): , , , , , (3) ( SMALL CAPS ): , , , , , ; ї л? (лLatin?) -- л? -- : (1) ( Roman ): , , , , , ; (2) ( Italic ): , , , , , ; (3) ( SMALL CAPS ): , , , , , ; (4) ( Bold ): , , , , , ; (5) ( Bold OT1, T1, T2A T2D. , : ї "" , , http://lizard.phys.msu.su 5 , - . T2A T2D, , , . ...

Еще в разделе: (Показать все результаты (>19) - lizard.phys.msu.su/ )

sp|Q81842|SHDAG_HDVP1 Small delta antigen ; MSQTVARLT-SKEREEILEQWVEERKNRRKLEKDLRRANKKIKKLEDENPWLGNVVGLL- RRKKDEDGAPPAKRPRQETMEVDSGPGRKPKARGFTDQERRDHRRRKALENKKKQLAGGG KHLSQEEEEELRRLARDDDERERRTAGPRPGGVNPMDGPPRGAPGGGFVPSLQGVPESPF SRTGEGIDIRGTQQFP sp|Q91DH8|SHDAG_HDVV2 Small delta ...

Еще в разделе: (Показать все результаты (>1817) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~a_anisenko/term2/text/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/deltaaligned.fasta

... H. Purcell: The Fairy Queen - Act IV . Г. Перселл: Королева фей - Акт IV . Act III . Акт III . ... Act V >> . Акт V >> . ... After Titania and Bottom have asleep the adaptation follows Shakespeare's third act with the confusion involving the two couples Hermia and Lysander, Helen and Demetrius, up to the point where they all fall asleep too. ... Phoebus appears on a cloud and greets the new day: the four Seasons enter and conclude the magnificent spectacle with songs and dances. ...

Еще в разделе: (Показать все результаты (>21) - music.genebee.msu.ru/ )

• G. F. Handel: Messiah - Part III
• G. F. Handel: Messiah - Part I
• G. F. Handel: Theodora - Part 2

... Russian Pages . CDFE: Home Page . ... Numerical data, graphics, and bibliography . ... description] . Last updated: May 6th, 2014 . ... Last updated: June 15th, 2011 . ... Last updated: . ... Last updated: April 4th, 2015 . ... Last updated: February 25th, 2016 . ... Last updated: September 27th, 2011 . ... Photonuclear Data Index since 1955 . ... Last updated: September 15th, 2015 . ... Last updated: March 22th, 2010 . ... Last updated: March 19th, 2015 . ... Last updated: May 15th, 2002 . ...

Еще в разделе: (Показать все результаты (>43) - cdfe.sinp.msu.ru/ )

• CDFE => Online services => Chart of Nuclear Quadrupole Deformations
• CDFE => Online Services => Relational ENSDF
• CDFE => Online Services => Nucleus Ground State Parameters

... Geophysics (Journal) . ... Geology of Death Valley (National Park) . Many links for Geophysics (earthquakes) . Geol 456/656 - Composition of the Earth . National Geophysical Data Center . USGS National Earthquake Information Center: Earthquake Information for the World . AGU : AGU Meetings . ... NEIC: Earthquake Search . ... AGU - American Geophysical Union . ... ETH Zurich, Institut fur Geophysik . ... Institut fur Geowissenschaften (Institute of Earth Sciences, Mineralogy Dept.) ...

Еще в разделе: (Показать все результаты (>20) - astrometric.sai.msu.ru/ )

• Baksan
• Astronomy
• Pictures, information about some cities

... file . ... file log . ... 1 Using library in-place . ... 18 NEWS file . ... 21 NEWS file contains news that are important to the library users, not to the . ... It must contain a word abot every change in any interfaces. ... 23 contain a word about bugfix, if that bugfix was important and could cause users . ... 26 The file grows upwards (like blog, so that all the most important things are at . ... 38 * change(!): critical library interface change . 39 * change: change in the library interface . ...

Еще в разделе: (Показать все результаты (>6215) - kodomo.fbb.msu.ru/ )

• allpy: 49d1ba7072a8 README.devel
• allpy: README.devel annotate
• Help to practice 9 (multiple alignment)

... It is being organized jointly by the Byurakan Astrophysical Observatory (BAO) and the Armenian Astronomical Society (ArAS). ... LIST OF LECTURERS AND LECTURES : Dr. Vladimir AIRAPETIAN (Goddard Space Flight Center, USA): Physics of Winds from Cool Evolved Stars Dr. Don BARRY (Cornell University ... (observation techniques and theory) Dr. Michel DENNEFELD (Institut d'Astrophysique de Paris, France): Introduction to spectroscopic observations Dr. Serguei DODONOV (Special Astrophysical ...

Еще в разделе: (Показать все результаты (>166) - sai.msu.ru/ )

• GCVS Research Group: Recent publications
• Презентация PowerPoint
• European Astronomical Society(EAS): NEWS

... 20.09.2009 . ... Moscow Vyatichi, November 9 - 11, 2009. ... In this work we study sum-frequency generation from the surface of an isotropic chiral medium in arbitrary interaction geometry of the paraxial light beams at fundamental frequencies. ... Within the first-order approximation approach, generally, the polarization state of light is distributed inhomogeneously in the reflected signal beam cross section, and the transversal intensity distribution is not Gaussian. ... Full publication text . ...

Еще в разделе: (Показать все результаты (>149) - ofvp.phys.msu.ru/ )

• Laboratory of solid-state lasers and coherent spectroscopy

... International Conference Advanced Carbon Nanostructures (ACNS'2015), June 29 - July 3, 2015, St. Petersburg, Russia. ... March 20, 2012, Moscow, Russia. ... IX International Conference Atomic and Molecular Pulsed Lasers, September 14th-18th, 2009, Tomsk, Russia. 21st Colloquium on High Resolution Molecular Spectroscopy, August 31st-September 4th 2009, Castellammare di Stabia, Italy. ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>44) - rswater.phys.msu.ru/ )

• Dmitry M. Karpov

... Menzerath's Law for Morphemic Structures of Words: . A Hypothesis for the Evolutionary Mechanism of its Arising and its Testing . Anatoliy A. Polikarpov . ... Key words: Menzerath's Law, morphemic structures, language evolution . ... In this paper there is present (1) a hypothesis for understanding the evolutionary mechanism responsible for the Law arising and (2) some data for testing the hypothesis. ... A Hypothesis. ... Altmann, G. Prolegomena to Menzerath's Law//Glottmetrika 2. ...

Еще в разделе: (Показать все результаты (>62) - old.philol.msu.ru/ )

• Dmitry V. Khmelev: List of Publications
• Basic Assumptions about a Sign's Life Cycle for Mathematical Modelling of
• Our publications

... ECOLOGICAL COOPERATION" . ... Brjanskaja oblast, Dubrovskij rajon, Seshcha (village), School . Brjanskaja oblast, Djat'kovskij rajon, Bytosh (village), School . ... Ivanovskaja oblast, Gavrilovo-Posadskij rajon, Borodino (village), School . Ivanovskaja oblast, Gavrilovo-Posadskij rajon, Yardenikha (village), School . ... Moscow, Children's Ecological Center of the National Park "Losinyj Ostrov" - the coordinator of ecological work of 18 Korolev-town's schools . Moscow, School #222 . ...

Еще в разделе: (Показать все результаты (>15) - www.ecocoop.ru/ )

... Ustynyuk Yu.A., Laikov D.N., Lunin V.V. Activation of CH 4 and H 2 molecules by cationic zirconium(IV) complexes: a DFT study. ... Laikov D.N. DFT study of [Cp ? 2 ZrCH 3 ]+[CH 3 B(C 6 F 5 ) 3 ] - ion pair formation. ... Ustynyuk Yu.A., Laikov D.N., Lunin V.V. Activation of C-H bonds in C 1 -C 3 alkanes by titanium(IV) and zirconium(IV) cationic complexes: a DFT study. ... Ustynyuk Yu.A., Laikov D.N., Lunin V.V. DFT study of the mechanism of alkane hydrogenolysis by transition metal hydrides. ...

Еще в разделе: (Показать все результаты (>29) - www.kge.msu.ru/ )

• Laboratory of Catalysis and Gas Electrochemistry

... О UNИX . ... Неизменяемая страница . ... Другие действия: Показать разметку Вид для печати Сформатировать как Docbook Очистить кэш страницы ------------------------ Проверить правописание Похожие страницы Карта окрестностей ------------------------ Переименовать страницу Удалить страницу ------------------------ Подписать пользователя ------------------------ Очистить от спама Вернуть эту версию Страницы пакета Синхронизировать страницы ------------------------ ...

Еще в разделе: (Показать все результаты (>134) - uneex.mithril.cs.msu.su/ )

• Index of /static/AltDocs_unix_base_admin/images
• PspoMaterials/AltDocs_install_sb - UNИX
• PspoMaterials/AltDocs_whatis_sb - UNИX

... Publication data for the ACAT'2002 Proceedings are available (you may download also a Word file ). ... Information on publication of the ACAT'2002 Proceedings and instructions on submission of contributions are available on our Web site. ... Everybody is invited to send interesting pictures! ... Materials (slides etc) of poster presentations appear in our Web data base (check "Programme" page). ... SLIDES of tutorials are available (check "Tutorials" page, then go to particular tutorial page). ...

Еще в разделе: (Показать все результаты (>54) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/25june.html
• http://acat02.sinp.msu.ru/page0.html
• http://acat02.sinp.msu.ru/plenary.html

... High Brightness RTM . ... Techniques to generate short, small emittance electron bunches of several nC at energies of several MeV are being developed to drive free electron lasers, for accelerator research, to provide short laser Thomson scattering X-ray pulses, and to generate intense coherent millimeter radiation (e.g., synchrotron, transition, etc.) ... Generating several tens of MeV beams now requires large, expensive, energy inefficient accelerators available only at large laboratories. ...

Еще в разделе: (Показать все результаты (>3) - vserv.sinp.msu.ru/ )