International Faculty Program Why This Program? The IESE Standard Why an IFP Program at IESE? ... The International Faculty Program (IFP) prepares business school professors to make outstanding contributions to their institutions through the development of critical teaching and leadership skills. ... Led by IESE faculty members, the IFP includes participants from diverse countries who typically hold management roles at their institutions, thus providing a highly rewarding learning experience. ...

Еще в разделе: (Показать все результаты (>104) - www.mgubs.ru/ )

• Doing Business in Russia | Высшая школа бизнеса МГУ им. Ломоносова
• Moscow Times о российских программах Executive MBA
• Высшая школа бизнеса МГУ им. Ломоносова

... Интегрированные среды разработки появились с расширением использования шейдеров в графических приложениях. Они позволяют быстро описывать различные эффекты при помощи комбинаций шейдеров, параметров, текстур, моделей и т.д. и получать готовый результат. ... Обычно такие среды являются многоплатформенными, т.е. поддерживают ГПУ различных производителей и различные графические технологии программирования. ... Интегрированные среды разработки могут быть рекомендованы начинающим программистам ГПУ. ...

Еще в разделе: (Показать все результаты (>4) - gpu.parallel.ru/ )

Variety of Long-Eared Owls (Asio otus L.) Diet as Index of Habitats Usefulness. ... Owls draw to themselves attention, due to a number of such features, as a wide circulation practically in all natural zones, an originality of ecology, behavior and morpho-physiology; prospect synantropisation some species on a background of disturbing decrease in number of others, difficultly observable and, still, poorly studied. ... Adult owl brings young sparrow from birddealer to his fledgling. ...

Еще в разделе: (Показать все результаты (>75) - vertebrata.bio.msu.ru/ )

• http://vertebrata.bio.msu.ru/Shedlock_Okada_2000_BE.pdf
• http://www.sevin.ru/fundecology/speciation/Baker-GSC-2006(21).pdf
• http://vertebrata.bio.msu.ru/Ogurtsov_RJH_2004.pdf

... The kinetics of the ESR signal from P700 (ESR signal I) was recorded at different concentrations of exogenous ferredoxin, ,A kinetic model was developed for ferredoxin-dependent cyclic electron transport around photosystem I. A multiparticle model was built to directly describe electron transfer in multienzyme complexes and restricted diffusion of mobile carriers in individual compartments (stroma, lumen, intramembrane space) of the system. ... Ferredoxin Lumen Photosystem I Plastocyanin Fig. ...

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3334.pdf
• http://library.biophys.msu.ru/matorin/3407.pdf
• http://library.biophys.msu.ru/PDF/3340.pdf

... Russia as well as other countries of the world was actively combating the economic downturn. ... And the country still has an amount of reserves that will feed us for several years to come. ... Countries of South-East Asia, China develop dynamically. Even in crisis times their growth rate made 8%. ... We, on the contrary, practice a very conservative approach the reserves are a kind of sacred cow: they cannot be used for anything except exchange rate regulation, which is erroneous. ...

Еще в разделе: (Показать все результаты (>23) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/Russia_2010_MSE_en.pdf
• http://www.mse-msu.ru/Ayvazyan_Introduction_to_the_textbook_on_econometrics.pdf
• http://www.mse-msu.ru/Maevsky,%20Zorin%20-%20Managed%20monetary%20accelerator.pdf

Space Weather . ... Space weather . ... Data . ... You should fill in "Workspace" by groups of data sets to create plots. ... Putting different kind of data into the same plot remember, that the first dropped data set chooses and determines the axis scale for all data. ... If you need both kind of scale in the same plot, create two different plots and unite them. The speed of this service depends on 3 components: data processing on server, data transmission and data plotting in your browser. ...

Еще в разделе: (Показать все результаты (>3) - swx.sinp.msu.ru/ )

... Faculty of Physics . M.V.Lomonosov Moscow State University . ... 03.02.2005 . ... To attract new employees, SAMSUNG Electronics holds SAMSUNG Job Fair 2005. ... The SAMSUNG Job Fair 2005 is oriented toward Ph.D. people, Ph.D. students, experienced people, and graduates majoring in computer science, cybernetics, applied mathematics, telecommunications, microelectronics, radio engineering, radio physics, semiconductor physics, quantum electronics, and optics. ... 119991, Moscow, . ...

Еще в разделе: (Показать все результаты (>106) - phys.msu.ru/ )

by Margarita Dzhalalova It is known that the pressure difference values for a round parachute are constant over total canopy, then for a square parachute the values of pressure difference are non-uniform along radial ribbons differing even from each other and depending mainly on certain sets of line lengths, and therefore square parachutes attain different shapes from each other ( Fig.1 - photo of var.1 and var.2). ... Distribution of pressure coefficient along radial ribbons of square parachute. ...

Еще в разделе: (Показать все результаты (>8) - margaret.imec.msu.ru/ )

• On Square Parachute Differential Equations

THE JOURNAL OF CHEMICAL PHYSICS 133, 144101 2010 Effective numbers of modes applied to analysis of internal dynamics of weakly bound clusters A. A. Rybakov,a E. D. Belega, and D. N. Trubnikov Department of ... Russia Received 11 June 2009; accepted 14 September 2010; published online 11 October 2010 The dependence of the volume of the chaotic component in the internal dynamics of triatomic van der Waals clusters on the angular ... When such difference is small, the regular motion disappears. ...

Еще в разделе: (Показать все результаты (>18) - beams.chem.msu.ru/ )

• http://beams.chem.msu.ru/sotrudniki/larin/IJQCh_04.pdf

trendence Graduate Barometer Europe 2011 About the survey ­ About trendence trendence Graduate Barometer Europe is an annual online student survey which allows students to express their opinion on topics re lated to career and education. ... Ulrike Heyne Project Manager trendence Graduate Barometer Europe 2011 About the survey Facts and benefits How does it work? ... If your students take part in the trendence Graduate Barometer, they will receive an exclusive Student Report. ...

Еще в разделе: (Показать все результаты (>3) - studsov.math.msu.su/ )

... The first part of the paper is devoted to representing integrable systems in a conformally Hamiltonian form. ... MSC2010 numbers: 37Jxx DOI: 10.1134/S1560354711050030 Keywords: conformally Hamiltonian system , non-holonomic system , invariant measure , periodic tra jectory, invariant torus, integrable system Contents INTRODUCTION 1 HAMILTONIZATION IN A NEIGHBORHOOD OF A TWO-DIMENSIONAL INVARIANT MANIFOLD 1.1 Theorem on Rectification of a Vector ... Let us find the vector field J dH ....

Еще в разделе: (Показать все результаты (>113) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/d2d/196-the-dynamics-and-control-of-a-spherical-robot-with-an-internal-omniwheel-platform_ru.pdf
• http://ics.org.ru/upload/iblock/336/170-statistical-irreversibility-of-the-kac-reversible-circular-model_en.pdf
• http://ics.org.ru/upload/iblock/650/122-kinetics-of-collisionless-continuous-medium_ru.pdf

... The Informativeness of Coherence Analysis in EEG Studies A. P. Kulaichev UDC 612.821.6 Translated from Zhurnal Vysshei Nervnoi Deyatel'nosti imeni I. P. Pavlova, Vol. ... KEY WORDS: coherence, spectral analysis, EEG non-stationarity, amplitude modulation. ... In particular, the two fundamental differences between EEG signals and most other physical signals are not considered: a) fundamental non-stationarity; b) amplitude modulation at all frequency ranges. ... Coherence in technical addenda. ...

Еще в разделе: (Показать все результаты (>18) - www.protein.bio.msu.ru/ )

• http://www.protein.bio.msu.ru/~akula/Kulaichev%20Addition.pdf

... THE TIME HAS COME FOR "THUNDER BOOKS" . ... You may have forgotten what a thunder book is, or maybe you didn't ever use that name. ... It is a handy reference to those things you need to know about soils and how they behave. ... Well, if you knew how to use them as pages in a thunder book it would surely be a good start, but you need something uniquely yours. ... It has always been my belief that the mission of a soil survey is to help people understand and wisely use soil resources. ... Good read. ...

Еще в разделе: (Показать все результаты (>2) - www.paleopedology.msu.ru/ )

• Commission on Paleopedology Discussions

Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>26) - foroff.phys.msu.ru/ )

• Глубокоуважаемые коллеги
• Postdoctoral training (Cosmic Rays and Physics of Space)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/insilicobiol_2003.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

... CENTRE FOR PHOTONUCLEAR EXPERIMENTS DATA . Online Services | ... CDFE: Online Services . ... Coded (machine-retrievable) information . ... DATA . ... This appendix provides a listing of all information-identifier keywords, along with details about their use. ... The general format of the coding string consists of three major fields which may be preceded by a decay flag: ((decay flag)nuclide,half-life,radiation). ... Gives information on references that contain information about the data coded. ...

Еще в разделе: (Показать все результаты (>25) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => NSR Search Engine
• EXFOR Search Engine
• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei

... 8 OpenFlow , , , , , , NAT, ARP, DNS, DHCP, BGP , , web · ­ · events per second · >10M · "" ­ · us · ­ 24/7 · ­ : ­ (2013) · · · · · · · · · NOX-Classic NOX Beacon Floodlight SNAC Ryu POX Maestro Trema · · · · · · · · · Helios FlowER MUL McNettle NodeFlow Onix SOX Kandoo Jaxon · Cisco ONE controller · Nicira NVP Controller · Big Network Controller · IBM Programmable Network Controller · HP SDN Controller · NEC Programmable Flow 11 · ­ ­ · ­ · ­ · ­ OpenFlow 12 5/30/2013 13 (2013) · 7 000 000 . ...

Еще в разделе: (Показать все результаты (>6) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_advanced_networks/ITU_OTN_Tutorial.pdf
• http://lvk.cs.msu.su/~bahmurov/course_realtime/papers/balashov_et_al_eucass2011_monitoring.doc

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>11) - www.sciencepark.ru/ )

Example of the Matrix of Size 6?6 with Different Tropical Rank and Kapranov Rank / Shitov Ya.N. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>106) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

Electron and proton impact ionization of atoms and molecules . Theory of few-body Coulomb scattering This is one of the major topics in the research activity of our laboratory. ... Electron momentum spectroscopy (EMS) EMS is the (e,2e) method involving high incident energy and large momentum transfer. ... We develop a theory of the single- and double-ionization EMS processes in atomic and molecular systems. ... c) Laboratory of mathematical models of quantum scattering processes, 2012 . ...

Еще в разделе: (Показать все результаты (>8) - lmmqsp.sinp.msu.ru/ )