... Спецкурс "Программирование на Языке Фортран" (профессор Б.П. Рыбакин) . Автор: Administrator . 06.10.2013 11:59 . С 10 октября 2013 года начнется чтение спецкурса "Программирование на Языке Фортран". ... Занятия проводятся по четвергам в аудитории 405, 1-й учебный корпус, начало в 14:30. Обновлено 10.10.2013 09:56 . Спецкурс "Технология параллельного программирования" (профессор Б.П. Рыбакин) . ... Спецкурс "Программирование для Графических ускорителей" (профессор Б.П. Рыбакин) . ...

Еще в разделе: (Показать все результаты (>15) - hpcdep.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

Prehistoric Contacts between Hittite and Luvian: The Case of Reflexive Pronouns* Ilya Yakubovich University of Chicago The origin of the Hittite reflexive clitic = za represents an unsolved problem in Anatolian and Indo-European Studies. ... Hittite = za owes its existence to the paradigmatic generalization of the borrowed Luvian 2/3sg. reflexive clitic *=ti/*=di while the Luvian form must be derived from the Indo-Hittite dative clitic *= toi `to thee'. ... Hittite borrows Luvian *=ti/=*di. ...

Еще в разделе: (Показать все результаты (>12) - imk.msu.ru/ )

• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/lydian.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/upe.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/ENEMY.pdf

... Basic statement: "Mathematics is much clever, than Mathematician" It means, that after the scientist or engineer developed new mathematical model and designed corresponding equations, the solution to these equations produces new information unpredictable for the author! ... This vibration excites the shear wave in tissue 2 sx 2 - (ct + ) s x = Fx 2 t t Studies in Fluid Dynamics of water jet are connected with two main problems: 1. Flows in contracting nozzle forming high-speed jet. ...

Еще в разделе: (Показать все результаты (>39) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/perehody.pdf
• http://acoustics.phys.msu.su/teachers/gusev_files/diff2011.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/polosa3.pdf

МГУ имени М.В.Ломоносова Русская версия . ... Geography . ... 29 Feb 2016 . ... Head of Department of Economic and Social Geography of Russia, Chair of Commitee of Scientific and Research work, Doctor of Geography. ... Prof. Alexandr Gennadiev - Deputy Head of Department of Landscape Geochemistry and Soil Geography, Doctor of Geography. Prof. Kirill Dyakonov - Head of Department of Physical Geography and Landscape Science, Corresponding Member of Russian Academy of Sciences, Doctor of Geography. ...

Еще в разделе: (Показать все результаты (>100) - conf.msu.ru/ )

The dynamics of reconstitution of microtubules around the cell center after cooling I. A. Vorobjev1), Yu. ... The number of microtubules diverging radially from the mother centriole reaches a maximum after 15 to 16 min, that of microtubules growing from the daughter centriole 12 min after the cells are placed at 37 °C. 45 min after the heating started the number of radially diverging microtubules shomewhat exceeds the control level. ... I. The average number of microtubules radiating from centrioles. ...

Еще в разделе: (Показать все результаты (>35) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/Alieva04.pdf
• publications2

... 7­8, 2000 UDC 620.18:65.012.12.001/002 REPRODUCIBILITY OF THE STRUCTURE AND PROPERTIES OF PARTS AND THEIR DESCRIPTION WITHIN THE FRAMEWORK OF NONLINEAR DYNAMICS A. Yu. ... The problem of the reproducibility of complex structures is discussed from the standpoint of the applied theory of dynamic systems. ... The problem of the reproducibility of complex structures that appear in nonlinear media has become closely connected with some problems of the applied theory of dynamic systems. ...

Еще в разделе: (Показать все результаты (>62) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/JPA_DLA_2007.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/JPA_2000_bill.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/DCDS-B_06.pdf

... In Richet's experiments, a human subject was able to guess (with above chance accuracy) randomly drawn playing cards even, if no sender looked at the cards. ... For this purpose, I built a quantum based random number generator (Schmidt, 1970) that could generate the numbers 0, 1,2, and 3 in a random sequence. ... One finds that some subjects can affect the random generator under these conditions, and the effect has been confirmed by a large number of different experimenters. ... Schmidt, H. (1969a)....

Еще в разделе: (Показать все результаты (>25) - erg.biophys.msu.ru/ )

• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики
• gromacs ERG Research Group: Лаборатория теоретической биофизики
• All-atom automatic OPLS-AA topology generator ERG Research Group: Лаборатория

Federation of European Societies on Trace Elements and Minerals PRELIMINARY SCIENTIFIC PROGRAM 09.06.2010 SESSION 1. Trace element and mineral analysis of environmental and biological samples: bulk determination, speciation and quality control. ... 10.06.2010 SESSION 2. ... SYMPOSIUM ORGANIZATION Venue The 4th International Symposium on Trace Elements and Minerals in Medicine and * Biology will take place in the Hotel "Okhtinskaya" (4, Bolsheokhtinsky prospect, 195027 St.Petersburg, Russia). ...