... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>4) - npidb.belozersky.msu.ru/ )

... The following diets will be discussed: . ... michael kors outlet uk . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key ...

Еще в разделе: (Показать все результаты (>98) - elana.sinp.msu.ru/ )

• cheap michael kors Cyclacel Pharmaceuticals? CYCC CEO Spiro Rombotis on Q2 2015
• cheap ralph lauren Fellowship of Christian Athletes Scholarships | С Днем
• travellers | С Днем Победы!

... Smurova KM, Alieva IB, Vorob'ev IA. Free and centrosome-attached microtubules: quantitative analysis and themodeling of two-component system. ... Genes Cells. ... Mimori-Kiyosue Y, Grigoriev I, Lansbergen G, Sasaki H, Matsui C, Severin F, Galjart N, Grosveld F, Vorobjev I, Tsukita S, Akhmanova A. CLASP1 and CLASP2 bind to EB1 and regulate microtubule plus-end dynamics at the cell cortex. J Cell Biol. ... Cell Biol Int. 2004;28(2):139-50. ... Membr Cell Biol. 1997;11(2):195-211. in Russian . ...

Еще в разделе: (Показать все результаты (>35) - cellmotility.genebee.msu.ru/ )

. Prague, August 16, 2006 . Present classification : Suggested: SR, SRA, SRB, SRC, SRS SR (the regularity level should be indicated by the presentation of the light elements; if a star is a supergiant, it will be obvious from its spectral type) SRD SRd (we feel not inclined to introduce the UU Her type) ZZ, ZZA, ZZB, ZZO ZZ (subtype is contained in the spectral type) . BLBOO BLBoo . GDOR GDor . PULSATING VARIABLES (CONTINUED)

Еще в разделе: (Показать все результаты (>87) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Variability Types
• General Catalogue of Variable Stars: What's new.

... The linguistic aspects of the model and the properties of the semantic dictionary ensuring the content analysis with compression of the text structure are considered. Our dictionary resources serve an instru- ment for building a multilevel textual semantic structure. ... Reason (A,B), where SemF(A) = SIT or a whole semantic formula; the same for SemF(B). ... Sem(SIT)R . ... Semantic Resources for Textual Content Compression // Fourth International Conference on Meaning-Text Theory (MTT'09). ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Semantic Dictionary for Text Understanding and Summarization

... Institutes of Chernogolovka . The largest of all the scientific institutions of the center is the Institute of Chemical Physics in Chernogolovka , where fundamental problems of chemical physics are studied: kinetics and mechanisms of chemical and biological processes; processes of combustion, explosion, and polymerization; and mechanisms of elementary reactions involving high energy particles. ... Developments and Technologies . ...

Еще в разделе: (Показать все результаты (>17) - www.issp.ac.ru/ )

• About RATAN
• Comet Ephemerides

Nuclear Instruments and Methods in Physics Research B 150 (1999) 640?644 PIXE, XRF and GRT for the global investigation of ancient gold artefacts Guy Demortier *, Yvon Morciaux, Daphn Dozot e LARN, Facultes Universitaires Notre-Dame de la Paix, 61, Rue de Bruxelles, 5000 Namur, Belgium Abstract The study of ancient gold jewellery artefacts often requires surface and bulk characterisation using non-destructive methods. ... Both proўles are calculated using the dierential PIXE method [6]. ...

Еще в разделе: (Показать все результаты (>87) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/articles/04a2Da.pdf
• http://hbar.phys.msu.ru/articles/ligorep97.pdf
• http://hbar.phys.msu.ru/gorm/ahist/antikythera5.pdf

... Electronic journal Issue 4. 10 september 2004 Vorontchuk, Cox III R.W. Developing a Competency-based Career Training and Professional Development Program for Latvia INTRODUCTION. ... With the support of a grant from the NISPAcee a team from the Latvian School of Public Administration, the University of Latvia and the University of Akron (Ohio, USA) prepared for the Chancellery of Latvia a proposal for the creation of a career-long professional development program for those in the civil service. ...

Еще в разделе: (Показать все результаты (>7) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./leigh.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./ulrich.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>10) - lhe.sinp.msu.ru/ )

... Font: Times New Roman . ... size - А4 (21 cm х 29,7 cm) . ... Title should be typed in capital letters, Times New Roman, size 13, boldface font; formatting: center. ... The title and the number of the table should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... The title under the illustration should be center-formatted (Times New Roman, size 11, single-spaced, no period/full stop at the end of the title). ... Use Times New Roman size...

Еще в разделе: (Показать все результаты (>25) - www.spa.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

VES visualization as the dependence Rho a =f ( r ) is suitable for analysis of only HLS . ... For that the special visualization program IPI-2D was developed, which helps to draw VES data in many forms. a) Rho a cross-sections for AMN & MNB pole-dipole arrays give the first representation of structure under investigation, its inhomogeneity and NSI influence (see fig.7 ). b) D - transformations gives the difference between AMN & MNB (D) and its horizontal derivative - dD/dX (R) . ...

Еще в разделе: (Показать все результаты (>61) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

Federation of European Societies on Trace Elements and Minerals PRELIMINARY SCIENTIFIC PROGRAM 09.06.2010 SESSION 1. Trace element and mineral analysis of environmental and biological samples: bulk determination, speciation and quality control. ... 10.06.2010 SESSION 2. ... SYMPOSIUM ORGANIZATION Venue The 4th International Symposium on Trace Elements and Minerals in Medicine and * Biology will take place in the Hotel "Okhtinskaya" (4, Bolsheokhtinsky prospect, 195027 St.Petersburg, Russia). ...

Еще в разделе: (Показать все результаты (>6) - www.fbm.msu.ru/ )

• http://www.fbm.msu.ru/about/struct/labs/lima/paper1.pdf
• http://www.fbm.msu.ru/about/struct/labs/lima/paper7.pdf

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Вакансии . ... Software engineering for mobile internet service development . ... Design and development of applications on PC (Windows) . Design and development of embedded applications on IT device (WM, Linux, S60, other ARM-based embedded OS ) . ... 1) C/C++ and Java (J2ME) language skill . 2) Windows based development skill (WIN32, ATL, COM, WPF, DirectShow Filter, etc.) ...

Еще в разделе: (Показать все результаты (>79) - www.physcareer.ru/ )

• Software Engineer (Server) / Вакансии / Physcareer.ru
• Mobile Handset Hardware Developer / Вакансии / Physcareer.ru
• Messaging Application Developer in Android Platform / Вакансии / Physcareer.ru

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... His longevity is said to be the result of a yogic practice known as kaya kalpa , or transformation of the body . One of the most elusive subjects to come out of the East, kaya kalpa remains shrouded in mystery and contradiction. ... So then, what must kaya kalpa for the current age entail? ... It is difficult to discern clearly what remains intact from the ancient Tamil kaya kalpa traditions. ...

Еще в разделе: (Показать все результаты (>256) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Senior International Fellows Program
• Клуб выпускников МГУ: Таблетка-чип, заменяющая врача. умная таблетка, smart...
• Клуб выпускников МГУ: AGEING Dr.Sula - General Overview 2008

... PHASE TRANSITIONS Ferroelectricity and Pressure Induced Phase Transitions in HgTiO3 A. I. Lebedev Moscow State University, Moscow, 119899 Russia e mail: swan@scon155.phys.msu.ru Received December 21, 2011 Abstract--Using ab initio density functional theory, the ground state of mercury titanate is determined and phase transitions occurring in it at pressures P 210 kbar are analyzed. It is shown that the R3c structure experimentally observed in HgTiO3 is metastable at P = 0. ...

Еще в разделе: (Показать все результаты (>61) - scon155.phys.msu.su/ )

• http://semiconductors.phys.msu.ru/publ/PhysSolidState_56_449.pdf
• http://semiconductors.phys.msu.ru/publ/PhysSolidState_49_1132.pdf
• http://semiconductors.phys.msu.ru/publ/PhysSolidState_51_362.pdf

... EXPERIMENTAL ARTICLES Intrapopulation Heterogeneity of the Fluorescence Parameters of the Marine Plankton Alga Thalassiosira weissflogii at Various Nitrogen Levels E. N. Voronovaa, L. V. Il'asha, S. I. Pogosyana,1, A. Yu. ... Some cells within the population were more sensitive to nitrogen deficiency, and their photosynthetic apparatus was disrupted to a greater extent. ... Enhancement of nitrogen deficiency resulted in an increase in the variability of the Fo and Fv/Fm values of the cells. ... Vol....

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3345.pdf
• http://library.biophys.msu.ru/matorin/3398.pdf
• http://library.biophys.msu.ru/matorin/3371.pdf