... MAGNETISM AND FERROELECTRICITY Parameters of the Potential Well of an Off-Center Ge Atom in a GeTe­SnTe Solid Solution A. I. Lebedev and I. A. Sluchinskaya Moscow State University, Vorob'evy gory, Moscow, 119992 Russia e-mail: swan@scon155.phys.msu.su Received September 11, 2006 Abstract--An method is proposed for determining the shape of the three-dimensional multiwell potential of an off-center atom from EXAFS data. ... is the distance between the absorbing and 2 scattering atoms. ...

Еще в разделе: (Показать все результаты (>94) - scon155.phys.msu.su/ )

• http://semiconductors.phys.msu.ru/publ/CRRS94.pdf
• http://semiconductors.phys.msu.ru/publ/PhysSolidState_51_2324.pdf
• First-principles calculations of physical properties of crystals

Supernova 2002bl in UGC 5499 . This page is devoted to information on Supernova 2002bl in UGC 5499 Basic information on this SN, including the last reported brightness, on this Supernova can be found on the main page . Information on the original web pages for many of these images can be found on the updates and links web pages. ... A spectrum shows this to be another type Ib/c Hypernova (5th one). ... Icon generated from Mark Armstrong's discovery image. ... 2002/02/12.210 . ...

Еще в разделе: (Показать все результаты (>432) - www.rochesterastronomy.org/ )

• Supernova 2009js in NGC 918
• THE BRIGHT SUPERNOVA 1991T IN NGC 4527; AN AMATEURS PRESPECTIVE
• Supernova 2011dm in UGC 11861

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>3) - oc.cs.msu.ru/ )

SELECT data_key, data_value FROM xf_data_registry WHERE data_key IN ('options', 'languages', 'contentTypes', 'codeEventListeners', 'cron', 'simpleCache', 'routesPublic', 'bannedIps', 'styles', 'nodeTypes', 'smilies', 'bbCode', 'displayStyles', 'trophyUserTitles', 'reportCounts', 'moderationCounts') . ... Select Type . ... Ref . ... SIMPLE . ... PRIMARY . ... const . ... library/XenForo/ Autoloader.php . ... library/Zend/Registry.php . ... library/Zend/Config.php . ... library/Zend/Db/Select.php . ...

Еще в разделе: (Показать все результаты (>26) - osk.msu.ru/ )

• http://osk.msu.ru/forum/members/adollekautoto.2142/?_debug=1
• http://osk.msu.ru/forum/members/arbimeorirm.2192/?_debug=1
• http://osk.msu.ru/forum/members/catyfopwbex.2168/?_debug=1

... 1998 1 : Defended the Doctorate Degree Thesis on "Models of Cosmic Ray Particle Fluxes (Development and Applications)". ... Space Weather . ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv. ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv.Space Res. ...

Еще в разделе: (Показать все результаты (>8) - srd.sinp.msu.ru/ )

... 8 DOI: 10.1093/nar/gkh583 Mapping of the second tetracycline binding site on the ribosomal small subunit of E.coli Maria M. Anokhina1, Andrea Barta2, Knud H. Nierhaus3, Vera A. Spiridonova4 and Alexei M. Kopylov1,4,* Department of Chemistry ... University, 119992 Moscow, Russian Federation Received February 5, 2004; Revised March 22, 2004; Accepted April 14, 2004 1 ABSTRACT Tetracycline blocks stable binding of aminoacyltRNA to the bacterial ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf
• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf

... In this article, the light propagation in a diffuser with optically soft inclusions is described with the help of the Fokker­Planck equation, i.e., a transfer equation with a diffusion term in the space of radiation-propagation directions. The coefficient of angle diffusion is calculated using the Mie theory. The equation is solved numerically using the stochastic analog method, and the space and angle distribution of the radiation that passed through the diffuser is calculated. ...

Еще в разделе: (Показать все результаты (>15) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/science/jap-06.pdf
• http://lizard.phys.msu.su/home/science/redistr-sst99.pdf
• http://lizard.phys.msu.su/home/science/redistr-sst99.ps.gz

... In Chap. ... sign cos : By the theorem on the motion of the center of masses in the space in projections to the related axes .x ; y ; z/ and the theorem on the change of the kinematic moment with respect to these axes, we obtain the following complete system of differential equations in the dynamical quasi-velocity space R1 fvg S2 f; g C R3 fx ;y ;z g: v cos P v sin C y v sin sin P 2 2 z v sin cos C .y C z / D Fx =m; v sin cos C v cos ... I2 n0 d cos with variable coefficient....

Еще в разделе: (Показать все результаты (>35) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-168-1.pdf
• http://shamolin2.imec.msu.ru/art-102.pdf
• http://shamolin2.imec.msu.ru/art-185-2.pdf

... Formulation of the problem ­ angle about the mass center C IC = mR 2 ­ central moment of inertia m and R ­ mass and radius of the hula-hoop k ­ coefficient of viscous friction r ­ radius of the waist FT ­ friction force N ­ reaction force ­ angle between x and CO x = a sin t , IC m m Ё +k (R - (R - y = b cos t = -FT R r ) = m (x sin + y cos ) + FT Ё Ё Ё r ) 2 = m (x cos - y sin ) + N Ё Ё (R - r ) = R ­ non-slippage where constants 0 mod 2 are defined from + µ cos 0 = 0. ...

Еще в разделе: (Показать все результаты (>11) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/Belyakov_eng.pdf
• http://belyakov.imec.msu.ru/papers/PhysCon2005.pdf

... General ideas of classical game-theoretic analysis: Game in normal form (as a model of players interaction) -Several participants (players) - Several possible strategies for each player -Payoff functions Principle of Nash equilibrium (as a method to define agents strategies during their interaction) -Nash equilibrium is a basic concept of game theory. ... If is not an equilibrium then mutants with pure strategy that is a best reply to have grater payoff than the average payoff for the main...

Еще в разделе: (Показать все результаты (>18) - io.cmc.msu.ru/ )

• Кафедра Исследования Операций

About BAFIZ . ... BAFIZ is a program devoted to the development of a distributed network of the knowledge and data bases for research of fundamental properties of the matter and applied nuclear physics. The project sponsored by Russian Foundation of Basic Research , RFBR reference number is 95-07-19502. ... This Page is developed at Laboratory of Computational Mathematics, . ... Last updated on 2 September 1999 . Copyright 1999 Laboratory of Computational Mathematics (DRCM) ...

Еще в разделе: (Показать все результаты (>10) - dbserv.sinp.msu.ru/ )

• tunka_graph
• 3d Map Description

Photo-induced delayed luminescence ( DL ) following a visible light excitation in air-dry seeds of various plants has been observed. ... The shape of DL distribution curve depends on homogeneity of seed population. ... Veselova, T.V., Veselovskii, V.A., Rubin, A.B., Bochvarov, P.Z. Delayed luminescence of air-dry soybean seeds as a measure of their viability. ... Veselova, T.V., Veselovsky, V.A., Kozar, V.I., Rubin, A.B. Delayed luminescence of soybean seeds during swelling and accelerated aging. ...

Еще в разделе: (Показать все результаты (>6) - biophys.msu.ru/ )

• Stress of plant cells

... Basic Linux . ... PCMCIA . Sound . ... CLEVO 8750 running X Window . ... BIOS: Phoenix (256Kb Flash ROM, PnP 1.0a, APM 1.2, LBA) LCD: TFT 13.3" 1024x768 . ... PCMCIA: GL9382; 2x Type II or 1x Type III PC Card slots (with ZV support) . ... Battery: Ni-Mh or Li-Ion . ... Nor X Window neither PCMCIA worked. ... For CLEVO 8750, I found at least two RRs at which X Window works: 62Hz and 70Hz. ... To enable the mouse when working on console use GPM with "-dev/psaux -t ps2" options. ...

Еще в разделе: (Показать все результаты (>13) - uranus.sai.msu.ru/ )

• Irina Glushneva
• MERLAN

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf

... TernAPI program . ... TernAPI program is designed for ternapy phase diagrams calculation by means of the convex hull method. ... Quick calculation of isobaric-isothermal sections of ternary systems phase diagrams (1-30 sec.) ... Voskov A.L., Dzuban A.V., Maksimov A.V. TernAPI program for ternary phase diagrams with isolated miscibility gaps calculation by the convex hull method // Fluid Phase Equilib . ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>16) - td.chem.msu.ru/ )

... UHECR SINP MSU . ... News . UHECR news . TLE news . Lab's news . ... Publications UHECR . ... TUS Ultra high energy cosmic ray detector on-board the Lomonosov satellite . ... Using the analytic modeling of the electromagnetic cascades compared with more precise numerical simulations we describe the physical properties of electromagnetic cascades developing in the universe on CMB and EBL background radiations. ... The new feature of the analysis is " E max rule". ... all news . ...

Еще в разделе: (Показать все результаты (>12) - uhecr.sinp.msu.ru/ )

• UHECR news
• Новости КЛПВЭ

... Probable participation of 14-3-3 in tau protein oligomerization and aggregation. ... This review is focused on universal adapter proteins 14-3-3 that seem to be significant partners to tau protein in neurons. 14-3-3 interacts with nonphosphorylated tau and promotes its interaction with and phosphorylation by a number of protein kinases. 14-3-3 induces aggregation of nonphosphorylated tau and does not affect aggregation of tau phosphorylated at specific sites. ...

Еще в разделе: (Показать все результаты (>85) - biochem.bio.msu.ru/ )

• Generation of recombinant antibodies and means for increasing their affinity.
• Biochemistry Department of Moscow State University | Na,K-ATPase and its role
• Cofilin weakly interacts with 14-3-3 and therefore can only indirectly

... It carries out the basic communication op erations, such as b oundary exchanges and transp ositions of decomp osed data. ... Data distribution b efore transp osition. б б бвб бв б б б бвбв б бв б бвбв б б б б б бвбв б бв б бвбв б б бвб бв б б б бвбв б б бвбв б б б б б бвбв б бв б бвбв б б бвб бв б б б бвб бв б б б бвб бв б б б бвб бв б б б б бвбв б бв бвбв б бв бвбв б бв бвбв б бв бвбв б бв б бвбв б б бвб бв б б б бвб бв б б б бвб бв б б б ...

Еще в разделе: (Показать все результаты (>7) - geophys.srcc.msu.ru/ )

• http://geophys.srcc.msu.ru/library/wind_stress.pdf

GCVS Variability Types and Distribution Statistics of Designated Variable Stars According to their Types of Variability ======================================================================== I. GCVS Variability Types. ... Amplitudes usually do not exceed 0.1 mag. ... RR Variables of the RR Lyrae type, which are radially-pulsating giant A-F stars having amplitudes from 0.2 to 2 mag in V. Cases of variable light-curve shapes as well as variable periods are known. ... RV Variables of the RV Tauri type. ...

Еще в разделе: (Показать все результаты (>95) - sai.msu.ru/ )

• General Catalogue of Variable Stars: What's new.
• General Catalogue of Variable Stars: Variability Types
• Презентация PowerPoint

... The kinetics of the ESR signal from P700 (ESR signal I) was recorded at different concentrations of exogenous ferredoxin, ,A kinetic model was developed for ferredoxin-dependent cyclic electron transport around photosystem I. A multiparticle model was built to directly describe electron transfer in multienzyme complexes and restricted diffusion of mobile carriers in individual compartments (stroma, lumen, intramembrane space) of the system. ... Ferredoxin Lumen Photosystem I Plastocyanin Fig. ...

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3336.pdf
• http://library.biophys.msu.ru/matorin/3400.pdf
• http://library.biophys.msu.ru/matorin/3393.pdf