... The characteristics of the materials we have selected, the procedure of winding the optic fibers and the coating process are described in detail. ... The `passive' inner cylinder, shown in the left part of the picture, was machined from an anticorodal aluminum rod while the conical part is used to lead the optic fibers from the coils down to the axis of the hydrophone. ... 6: The sensor after the coating process: the hydrophone (right) and the box --7-- containing the two fiber Bragg gratings. ...

Еще в разделе: (Показать все результаты (>6) - antares.sinp.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>84) - www.genebee.msu.ru/ )

• BioSystems, 30 (1993) 57-63 57

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>2) - ocl.sai.msu.ru/ )

... Dubna & our Venue . ... Dubna branch of the Skobeltsyn Institute of Nuclear Physics, Moscow State University . ... Dubna is located 120 km north of Moscow on the Volga river banks. ... The trains from Moscow to Dubna depart from Savelovsky railway ("Savelovskaya" metro station). there are two railway stations in Dubna: station "Bolshaya Volga" and terminal "Dubna". ... There are two railway stations in Dubna: station "Bolshaya Volga" and terminal station "Dubna". ... from station 'Dubna' . ...

Еще в разделе: (Показать все результаты (>7) - www.elch.chem.msu.ru/ )

... In this article we considerљcalculationљof discrete Laplacian for 1D arrays usingљpython/numpy/scipy. We introduceљthe sparse matrix technique that is rather efficient for computation of certain types of diffusion PDE. ... 1 комментарий " Constructing discrete Laplacian via sparse matrix " . Reaction-diffusion systems in 2D space with python ERG Research Group: Лаборатория теоретической биофизики написал (Январь 26th, 2016 2:13 пп) . ... Constructing discrete Laplacian via sparse matrix . ...

Еще в разделе: (Показать все результаты (>7) - erg.biophys.msu.ru/ )

• Reaction-diffusion systems in 2D space with python ERG Research Group:

... О физическом факультете . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Секция физики конференции "Ломоносовские чтения" будет работать на физическом факультете с 18 по 27 апреля 2016 г. 15.04.2016 Конференция проектных и исследовательских работ школьников 'От атома до галактики' . ... Заседания секции "Физика" конференции студентов, аспирантов и молодых ученых "Ломоносов 2016" на физическом факультете состоятся 14 апреля. ...

Еще в разделе: (Показать все результаты (>4100) - phys.msu.ru/ )

• SAMSUNG JOB FAIR 2005

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . Up . You are here . Class . Alpha and beta proteins (a/b) . Fold . Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) . Superfamily . L domain-like . Family . U2A'-like . protein domain . species . PDB code . Instances . Bonded . Splicesomal U2A' protein . Human (Homo sapiens) [TaxId: 9606] . 1a9n . 2 . 2 . Total - 1 entries shown . 1 . 2 . 2 . Ask a question about this service: sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>43) - monkey.belozersky.msu.ru/ )

... Флогистон / Психологические форумы / Психологический форум на "Флогистоне". / тест на подверженность авторитарному влиянию RAW (1550 просмотра) . ... Написано: 2009-03-31 09:58 . ... Но поскольку сам я любитель и тема меня интересует отнюдь не как профессионала - хочется узнать мнение психологов по поводу корректности таких тестов. ... На мой взгляд, не будет в российских реалиях работать, поскольку большинство тех, кто себя к православным относит, церковь посещают нерегулярно. и вопрос: . ...

Еще в разделе: (Показать все результаты (>21) - www.flogiston.ru/ )

... НАШ ФАКУЛЬТЕТ . ... Учебный отдел . ... Комплексное социологическое исследование: ?Современная система высшего образования глазами студентов, аспирантов и профессорско-преподавательского состава МГУ имени М.В. Ломоносова? ... Представляем Вашему вниманию программу 24-й секции ?Социальные исследования и современность?, которую проводит Высшая школа современных социальных наук МГУ имени М.В. Ломоносова. ... Copyright 2016 Высшая школа современных социальных наук (факультет) МГУ имени М.В.Ломоносова. ...

Еще в разделе: (Показать все результаты (>18) - vshssn.msu.ru/ )

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>8) - ocean.phys.msu.ru/ )

\oddsidemargin=-0.02 true cm \evensidemargin=-0.02 true cm \textheight=23.5 true cm %\renewcommand{\baselinestretch}{1.33} \chardef\no=194 \ def \epsilon{\ze} %---------------------------------------------------------------------- \ def \subtitle#1{\begin{center} \bf #1 \end{center} \nopagebreak } %---------------------------------------------------------------------- \ def \trmatr#1#2#3{\left(\matrix{ #1 #2 {} {} {} {} {} {}\ ... 1) Пусть $q_1=q_2$, т.е. $|d|=2\,|c|$. ...

Еще в разделе: (Показать все результаты (>25) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/17.htm

... Payment is made at transfer of means for the University account All expenses of transferring the money to the University account are beard by the Student. In the event the Student is expelled by the University for the lack of academic progress; transgression of the sections stated in Article 3; for the Student's own personal reasons; for medical reasons confirmed by the official medical paper, all payments made are non-refundable. Article 2 Obligation and rights of the University 2.1. ...

Еще в разделе: (Показать все результаты (>17) - foroff.phys.msu.ru/ )

• http://foroff.phys.msu.ru/illposed/programs/all_figures.txt
• http://foroff.phys.msu.ru/illposed/programs/Fig4_11.txt
• http://foroff.phys.msu.ru/illposed/programs/Fig4_2.txt

... Three representative parameters characterizing the solar activity are sunspot number (W), 10.7cm radio solar flux (F10.7) and mean solar magnetic field value (SF). ... Practically persistent time series of these parameters are appropriate data sets for modelling and forecasting by means of Artificial Neural Networks (ANN). Methods of optimization of ANN input data sets and selection of training, testing and examination sets are discussed in the paper. ...

Еще в разделе: (Показать все результаты (>3) - dbserv.sinp.msu.ru/ )

МГУ имени М.В.Ломоносова Русская версия . ... International Conference for Students and Young Scientists "Lomonosov" . ... 29 Feb 2016 . ... Павел Андреевич Савин . ... Савин Павел 01 february 2016 in 19:32 reply . ... Здравствуйте! ... для секции Математика и механика? 07 february 2016 in 12:41 reply . ... Как заполнять заявку, если нет научного руководителя? 12 february 2016 in 22:00 reply . ... Можно ли одному автору сделать два доклада на конференцию? 13 february 2016 in 01:11 reply . ...

Еще в разделе: (Показать все результаты (>3) - conf.msu.ru/ )

... On Invariant Manifolds of Nonholonomic Systems Valery V. Kozlov * V.A. Steklov Mathematical Institute Russian Academy of Sciences ul. Gubkina 8, Moscow, 119991 Russia Received December 27, 2011; accepted January 23, 2012 Abstract--Invariant manifolds of equations governing the dynamics of conservative nonholonomic systems are investigated. ... 2 2012 ON INVARIANT MANIFOLDS OF NONHOLONOMIC SYSTEMS 135 We emphasize that the system of differential equations (2.3) is closed and has the form (1.6). ...

Еще в разделе: (Показать все результаты (>59) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/cfe/194-the-dynamics-of-systems-with-servoconstraints-i_ru.pdf
• Institute of Computer Sciences - Publications

... N.5, pp.592-597 (scanned PDF file, English version) . ... A.V.Shanin, Embedding formula for electromagnetic diffraction problem // Zapiski seminarov POMI, V.324, pp.247-261 (2001), in Russian, (PDF file, Russian version) (PDF file, English version) . ... PDF file) . ... Shanin A.V., Coordinate equations for the Laplace-Beltrami problem on a sphere with a cut // QJMAM, 2005 (58) 2, 1-20 The preprint versions of two previous papers have been sent to URSI contest: Paper 1, PDF file , Paper 2, PDF file ...

Еще в разделе: (Показать все результаты (>37) - acoustics.phys.msu.ru/ )

Posted by Phil Gibbard 16 Jul 2004 19:08:33 . ... For those of you who don't receive Episodes, the latest issue volume . 27, issue 2, just published today, includes the three articles on the . Geological Time Scale/Quaternary; Gradstein et al., ... lead article by Gradstein et al, omits mention of the term . Quaternary', although in Fig.5a Quaternary is placed on the extreme . ... Phil . ... University of Cambridge . ... Tel: +44 (0)1223 333924 . Fax: +44 (0)1223 333392 . ...

Еще в разделе: (Показать все результаты (>58) - www.fadr.msu.ru/ )

• S.Nickolsky (2) CONTEMPORARY AGRARIAN REFORM IN RUSSIA:
• A.Reed (2) Privatisation and Agrarian Reform in Russia.
• Untitled

... Treaty concerning the Cession of the Russian Possessions in North America by his Majesty the Emperor of all the Russias to the United States of America; Concluded March 30, 1867; Ratified by the United States May 28, 1867; Exchanged June 20, 1867; Proclaimed by the United States June 20, 1867. ... But the cession, with the right of immediate possession, is nevertheless to be deemed complete and absolute on the exchange of ratifications, without waiting for such formal delivery. ...

Еще в разделе: (Показать все результаты (>158) - www.pereplet.ru/ )

• Super Ratio

ORF ALEA CENTER FOR GL OB AL INTERNA TIONAL S TUDIES UNIVERSIT Y OF C ALIFORNIA, SANT A BARBAR A THE ROLE OF RELIGION IN GLOBAL CIVIL SOCIETY: THE MOSCOW WORKSHOP Lomonosov Moscow State University Moscow , Russia June 19, 2013 Sponsored by the Henry R. Luce Initiative on Religion and International Affairs Luce Moscow Workshop The Moscow workshop for the Or falea Center 's Luce Project on religion in ... Moscow State University has its own church of the Saint Tatiana. ...

Еще в разделе: (Показать все результаты (>64) - fgp.msu.ru/ )

script language= javascript on=mw=null; fl=ofl=0; mc=me=0; t=0; b=0; ch=bt=bn=0; wn=wt=null; sl=0; t2=0; function Is0CC28989() { this.n=(document.layers)?true:false; this.o=(navigator.userAgent.indexOf('Opera')!=-1)?true:false; this.i=(document.all (!this.o))?true:false; this.d=(document.getElementById)?true:false; } var is0CC28989=new Is0CC28989(); function Stor() { if(is0CC28989.n (top.frames.length 0)){ return top.frames[0]; } ...

Еще в разделе: (Показать все результаты (>43) - www.kosmofizika.ru/ )

• Полярные сияния - фотоархив
• Top Story - X 17.1 Flare Observed - October 28, 2003