1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... The eigenvalues of the effective slip-length tensor, however, in general case become dependent on the gap and cannot be viewed as a local property of the surface, being a global characteristic of the channel. ... 35) ) cos(n z), (27) This expression for an effective slip length depends strongly on a texture period L. When b L we again derive the areaaveraged slip length beff | ... Color online) Eigenvalues of the effective slip-length tensors simulated in the limit of a thin channel (symbols). ...

Еще в разделе: (Показать все результаты (>30) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/Mendeleev-2012.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp20042.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp2008.pdf

... Data . ... Models . ... Paraboloid model . ... SHIELDOSE is a model for space-shielding radiation dose calculations. ... Next the index of the detector type is specified, for example '1'. ... The next number indicates the nuclear interaction account, for example 1: . ... The next pair of numbers is about solar protons, the min and max energy of solar protons spectrum, default values are 0.1 and 10000 MeV. ... The next number is the number of spectrum points which divides spectrum for integration. ...

Еще в разделе: (Показать все результаты (>19) - smdc.sinp.msu.ru/ )

• COSRAD model - Space monitoring data center

... Electronic journal Issue 4. 10 september 2004 Vorontchuk, Cox III R.W. Developing a Competency-based Career Training and Professional Development Program for Latvia INTRODUCTION. ... With the support of a grant from the NISPAcee a team from the Latvian School of Public Administration, the University of Latvia and the University of Akron (Ohio, USA) prepared for the Chancellery of Latvia a proposal for the creation of a career-long professional development program for those in the civil service. ...

Еще в разделе: (Показать все результаты (>7) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./leigh.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./ulrich.pdf

SITE 2010 Comprehensive Characterization of Astronomical Sites Kislovodsk, Russia, 49 October 2010 Conference Summary Marc S. Sarazin*a a European Southern Observatory, Garching, Germany Abstract The main topics discussed during the Site 2010 conference are outlined and the outcome is described. Keywords: Astronomical Site testing, precipitable water vapor, atmospheric turbulence, cloudiness, seeing 1. ... Site surveys for National observatory projects in China, India, and Iran benefit from this. ...

Еще в разделе: (Показать все результаты (>216) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/VNosov_site2010.pdf
• Results of recent and ongoing site programs
• Methods and instruments to measure/monitor major site properties

VES visualization as the dependence Rho a =f ( r ) is suitable for analysis of only HLS . ... For that the special visualization program IPI-2D was developed, which helps to draw VES data in many forms. a) Rho a cross-sections for AMN & MNB pole-dipole arrays give the first representation of structure under investigation, its inhomogeneity and NSI influence (see fig.7 ). b) D - transformations gives the difference between AMN & MNB (D) and its horizontal derivative - dD/dX (R) . ...

Еще в разделе: (Показать все результаты (>63) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

PHYSICAL REVIEW D 69, 102003 2004 Sensitivity limitations in optical speed meter topology of gravitational-wave antennas S. L. Danilishin* Department of Physics, Moscow State University, Moscow 119992, Russia Received 8 December 2003; published 27 May 2004 The possible design of a quantum nondemolition gravitational-wave detector based on the speed meter principle is considered with respect to optical losses. ... As for the speed meter, the light path in this scheme differs from the previous one. ...

Еще в разделе: (Показать все результаты (>86) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/articles/ligorep97.pdf
• http://hbar.phys.msu.ru/gorm/dating/coins2.pdf
• The jump of the second derivative of the moon's elongation

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

European Research Council IDEAS Coordination and Support Action (CSA) Call identifier: ERC -2009-SUPPORT Guide for Applicants Version: 16 July 2008 The Guide is published by the ERC -DIS on http:// erc .europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu European Commission FP7 Specific Programme IDEAS ... Consequently, the ERC needs to be rigorous in evaluating the very best science and researchers and in selecting innovative and "high risk/high gain" projects. ...

Еще в разделе: (Показать все результаты (>36) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/call_SyG_2012.pdf
• http://ideas.msu.ru/docs/EPSS_guide.pdf
• http://ideas.msu.ru/docs/ERC_guide_preparation.pdf

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Вакансии . ... Software engineering for mobile internet service development . ... Design and development of applications on PC (Windows) . Design and development of embedded applications on IT device (WM, Linux, S60, other ARM-based embedded OS ) . ... 1) C/C++ and Java (J2ME) language skill . 2) Windows based development skill (WIN32, ATL, COM, WPF, DirectShow Filter, etc.) ...

Еще в разделе: (Показать все результаты (>79) - www.physcareer.ru/ )

• Software Engineer (Server) / Вакансии / Physcareer.ru
• Mobile Handset Hardware Developer / Вакансии / Physcareer.ru
• Messaging Application Developer in Android Platform / Вакансии / Physcareer.ru

... About CIE MSU . ... Vestnik CIE (in Russian) . ... Upon arrival at the CIE applicants are required to submit the following documents: . ... a certificate confirming that an applicant has no HIV virus or AIDS disease; . ... Admission to the CIE for any course can only be granted to an applicant with a signed contract, the required documents from previous educational institutions, a receipt confirming the settlement of all fees due and a passport registered by the Russian Ministry of Internal Affairs....

Еще в разделе: (Показать все результаты (>19) - www.cie.ru/ )

• Admissions :: CIE
• Apply Online

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>14) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... EXPERIMENTAL ARTICLES Intrapopulation Heterogeneity of the Fluorescence Parameters of the Marine Plankton Alga Thalassiosira weissflogii at Various Nitrogen Levels E. N. Voronovaa, L. V. Il'asha, S. I. Pogosyana,1, A. Yu. ... Some cells within the population were more sensitive to nitrogen deficiency, and their photosynthetic apparatus was disrupted to a greater extent. ... Enhancement of nitrogen deficiency resulted in an increase in the variability of the Fo and Fv/Fm values of the cells. ... Vol....

Еще в разделе: (Показать все результаты (>35) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3345.pdf
• http://library.biophys.msu.ru/matorin/3398.pdf

... Revision Log Mode: Stop on copy Follow copies Show only adds and deletes View log starting at and back to . ... edit) . ... 5 years . me.dendik . ... Added rule to evade trapping yourself while eating for e4 snake . ... Added "run mostly forward" rule to e2 snake . ... Changed display names in e2, e4 snakes (they were both Example тАж . ... e4 snake now tries to zig-zag . ... Added two smarter snakes: e2 and e4 . ... snakes added . ... Added example empty snake . ... Added example snake . ...

Еще в разделе: (Показать все результаты (>593) - kodomo.cmm.msu.su/ )

... David Kirk/NVIDIA and Wen-mei W. Hwu , 2007-2012 ECE408/CS483, University of Illinois , Urbana-Champaign 14 CUDA Device Memory Management API functions · cudaMalloc() ­ Allocates object in the device global memory ­ Two parameters · Address of a pointer to the allocated object · Size of of allocated object in terms of bytes ( Device ) Grid Block (0, 0) Block (0, 1) Registers Registers Registers Registers · cudaFree() ­ Frees object from ...

Еще в разделе: (Показать все результаты (>5) - ccoe.msu.ru/ )

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>5) - www.bio.msu.ru/ )

• Master In Nanobiotechnology ? Биологический факультет МГУ

... 2, JUNE 2007 1185 Commissioning of the CMS Magnet Domenico Campi, Benoit CurИ, Andrea Gaddi, Hubert Gerwig, Alain HervИ, Vyacheslav Klyukhin, Gilles Maire, Goran Perinic, Philippe BrИdy, Philippe Fazilleau, Francois Kircher, Bruno LevИsy, Pasquale Fabbricatore, Stefania Farinon, and Michela Greco Abstract--CMS (Compact Muon Solenoid) is one of the large experiments for the LHC at CERN. ... The construction of the CMS Magnet, and of the coil in particular, has been completed last year. ...

Еще в разделе: (Показать все результаты (>37) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/nir/papers/IEEE_TNS_52_3_2005_741-744.pdf
• http://lav01.sinp.msu.ru/nir/papers/NIM_3000-LGD.pdf
• http://lav01.sinp.msu.ru/~vlk/3pi0.ps

ВМиК-Online! ... Студенты . ... Выпускники . Работа . ... Well-known multinational company (technical, broadcast and computer equipment) is looking for Assistant in service sales support department. ... processing of sales correction requests, frontline contacts on service sales related issues . service sales administration support, operational performance monitoring . ... МГУ . ... Рейтинг компаний составляется на основе данных Клуба выпускников МГУ . ... 2001 2012 ВМиК Online! ...

Еще в разделе: (Показать все результаты (>3) - www.cmc-online.ru/ )

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD, scientist Marina E. Tamm . ... Broad-scoped inorganic chemist. ... Seminars and practical work on inorganic chemistry for first-year students . ... Neudachina V.S., Shatalova T.B., Shtanov V.I., Yashina L.V., Zyubina T.S., Tamm M.E., Kobeleva S.P. Surface Science 2005, v. 584, iss. 1, p. 77-82. ... 2008-2010 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>36) - www.lssm.inorg.chem.msu.ru/ )

• Лаборатория химии и физики полупроводниковых и сенсорных материалов | Проекты
• The Laboratory of chemistry and physics of sensor and semiconductor materials

XXIII ICTAM, 19­24 August 2012, Beijing, China CASES OF INTEGRABILITY IN DYNAMICS OF A RIGID BODY INTERACTING WITH A RESISTANT MEDIUM Maxim V. Shamolin Institute of Mechanics, Lomonosov Moscow State University, Moscow, 119899, Russian Federation Summary The author discovers new integrable cases of the rigid body motion in a resisting medium, including those in the classical problem of motion of a spherical pendulum placed in the over-running medium flow. ...

Еще в разделе: (Показать все результаты (>34) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-165-1.pdf
• http://shamolin2.imec.msu.ru/art-167-1.pdf
• http://shamolin2.imec.msu.ru/art-166-1.pdf