1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... The eigenvalues of the effective slip-length tensor, however, in general case become dependent on the gap and cannot be viewed as a local property of the surface, being a global characteristic of the channel. ... 35) ) cos(n z), (27) This expression for an effective slip length depends strongly on a texture period L. When b L we again derive the areaaveraged slip length beff | ... Color online) Eigenvalues of the effective slip-length tensors simulated in the limit of a thin channel (symbols). ...

Еще в разделе: (Показать все результаты (>30) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/Mendeleev-2012.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp20042.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp2008.pdf

... Data . ... Models . ... Paraboloid model . ... SHIELDOSE is a model for space-shielding radiation dose calculations. ... Next the index of the detector type is specified, for example '1'. ... The next number indicates the nuclear interaction account, for example 1: . ... The next pair of numbers is about solar protons, the min and max energy of solar protons spectrum, default values are 0.1 and 10000 MeV. ... The next number is the number of spectrum points which divides spectrum for integration. ...

Еще в разделе: (Показать все результаты (>19) - smdc.sinp.msu.ru/ )

• COSRAD model - Space monitoring data center

... Electronic journal Issue 4. 10 september 2004 Vorontchuk, Cox III R.W. Developing a Competency-based Career Training and Professional Development Program for Latvia INTRODUCTION. ... With the support of a grant from the NISPAcee a team from the Latvian School of Public Administration, the University of Latvia and the University of Akron (Ohio, USA) prepared for the Chancellery of Latvia a proposal for the creation of a career-long professional development program for those in the civil service. ...

Еще в разделе: (Показать все результаты (>7) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./leigh.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./ulrich.pdf

SITE 2010 Comprehensive Characterization of Astronomical Sites Kislovodsk, Russia, 49 October 2010 Conference Summary Marc S. Sarazin*a a European Southern Observatory, Garching, Germany Abstract The main topics discussed during the Site 2010 conference are outlined and the outcome is described. Keywords: Astronomical Site testing, precipitable water vapor, atmospheric turbulence, cloudiness, seeing 1. ... Site surveys for National observatory projects in China, India, and Iran benefit from this. ...

Еще в разделе: (Показать все результаты (>216) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/VNosov_site2010.pdf
• Results of recent and ongoing site programs
• Methods and instruments to measure/monitor major site properties

VES visualization as the dependence Rho a =f ( r ) is suitable for analysis of only HLS . ... For that the special visualization program IPI-2D was developed, which helps to draw VES data in many forms. a) Rho a cross-sections for AMN & MNB pole-dipole arrays give the first representation of structure under investigation, its inhomogeneity and NSI influence (see fig.7 ). b) D - transformations gives the difference between AMN & MNB (D) and its horizontal derivative - dD/dX (R) . ...

Еще в разделе: (Показать все результаты (>63) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

PHYSICAL REVIEW D 69, 102003 2004 Sensitivity limitations in optical speed meter topology of gravitational-wave antennas S. L. Danilishin* Department of Physics, Moscow State University, Moscow 119992, Russia Received 8 December 2003; published 27 May 2004 The possible design of a quantum nondemolition gravitational-wave detector based on the speed meter principle is considered with respect to optical losses. ... As for the speed meter, the light path in this scheme differs from the previous one. ...

Еще в разделе: (Показать все результаты (>86) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/articles/ligorep97.pdf
• http://hbar.phys.msu.ru/gorm/dating/coins2.pdf
• The jump of the second derivative of the moon's elongation

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>48) - sn.sai.msu.ru/ )

European Research Council IDEAS Coordination and Support Action (CSA) Call identifier: ERC -2009-SUPPORT Guide for Applicants Version: 16 July 2008 The Guide is published by the ERC -DIS on http:// erc .europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu European Commission FP7 Specific Programme IDEAS ... Consequently, the ERC needs to be rigorous in evaluating the very best science and researchers and in selecting innovative and "high risk/high gain" projects. ...

Еще в разделе: (Показать все результаты (>36) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/call_SyG_2012.pdf
• http://ideas.msu.ru/docs/EPSS_guide.pdf
• http://ideas.msu.ru/docs/ERC_guide_preparation.pdf

... Ярмарка вакансий и стажировок для студентов и выпускников вузов . Новости науки и техники События . ... Вакансии . ... Software engineering for mobile internet service development . ... Design and development of applications on PC (Windows) . Design and development of embedded applications on IT device (WM, Linux, S60, other ARM-based embedded OS ) . ... 1) C/C++ and Java (J2ME) language skill . 2) Windows based development skill (WIN32, ATL, COM, WPF, DirectShow Filter, etc.) ...

Еще в разделе: (Показать все результаты (>79) - www.physcareer.ru/ )

• Software Engineer (Server) / Вакансии / Physcareer.ru
• Mobile Handset Hardware Developer / Вакансии / Physcareer.ru
• Messaging Application Developer in Android Platform / Вакансии / Physcareer.ru

... About CIE MSU . ... Vestnik CIE (in Russian) . ... Upon arrival at the CIE applicants are required to submit the following documents: . ... a certificate confirming that an applicant has no HIV virus or AIDS disease; . ... Admission to the CIE for any course can only be granted to an applicant with a signed contract, the required documents from previous educational institutions, a receipt confirming the settlement of all fees due and a passport registered by the Russian Ministry of Internal Affairs....

Еще в разделе: (Показать все результаты (>19) - www.cie.ru/ )

• Admissions :: CIE
• Apply Online

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016