. При написании HTML на сайте вы можете использовать любые HTML-теги для создания нужных вам эффектов. Вы должны размещать код в ячейке таблицы, учитывая следующее: . ; . , который может нарушить структуру страницы сайта. Список всех файлов помощи . Show this help in language: English .

Еще в разделе: (Показать все результаты (>2) - opp.psy.msu.ru/ )

A.S.Rubashny, D.D. Sokoloff, Mean magnetic energy in Riemannian spaces of constant curvature, Межд. конф. Теория вероятностей и ее приложения, посв. 100-летию Б.В.Гнеденко, Тезисы докл., М., URSS, 2012, с. 124. The energy growth of the mean magnetic energy driven by a small-scale dynamo in Euclidean and Lobachevsky spaces is discussed. ...

Еще в разделе: (Показать все результаты (>105) - srcc.msu.ru/ )

• Brandenburg A., Sokoloff D., Subramanian K., Current status of turbulent dynamo
• Oseledets I.V., Tyrtyshnikov E.E. Algebraic wavelet transform via quantics
• D.Sokoloff, Long-term dynamics of solar cycle, geomagnetic reversals and

. Himalayas . Altai . Tyn-Shan . California . Jukovsky . Air Show . Caucasus . Crete . Games . WebMaster . Copyright 1996-1998 Photography Art Collection, All Rights Reserved.

Еще в разделе: (Показать все результаты (>9) - top.sinp.msu.ru/ )

• http://top.sinp.msu.ru/lev/d0note_3612.ps

... More Reports . ... Discriminate function analysis of 403 calls from 14 individuals (29-30 calls per individual from 13 animals and 14 calls from one individual) showed 95.3% correct assignment to individual, and this substantially exceeds the expected random value for 14 animals (7.1%). ... Discriminate function analysis of 104 calls (30 calls per animal for three and 14 from the forth) from sample of 2001 and 2002 showed 100% correct assignment. ... Research * Student Reports . ...

Еще в разделе: (Показать все результаты (>66) - vertebrata.bio.msu.ru/ )

• Выступления студентов и аспирантов на конференциях

.. - , .., . . , ., . (email: vasilenkovv@mail.ru) , , , , Pitirim Sorokin, the origins of the theory of the Russian period, American period of activity . , , . , , : . The author briefly describes the biography of Pitirim Sorokin as a man, scholar, teacher and public figure. The article describes Russian and the U.S. periods in life of the researcher, shows the sources of his theory and analyzes the main works: articles and books.

Еще в разделе: (Показать все результаты (>34) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2010/3/03.pdf
• http://www.socio.msu.ru/vestnik/archive/2010/4/08.pdf
• http://www.socio.msu.ru/vestnik/archive/2012/3/01.pdf

... The project aims to obtain a number of ferrites 3d elements M II Fe 2 O 4 ( M II = Mn , Fe , Co , Ni , Cu , Zn ) with high surface area and nanometer crystallite size for selective chemical sensors. The catalytic and sensory properties of ferrite spinel structure shows dependence on the nature of the cation M II to surface chemical properties: strength and concentration of acid sites and redox ability. ... 2008-2014 Лаборатория химии и физики полупроводниковых и сенсорных материалов. ...

Еще в разделе: (Показать все результаты (>40) - www.lssm.inorg.chem.msu.ru/ )

• The Laboratory of chemistry and physics of sensor and semiconductor materials |
• The Laboratory of chemistry and physics of sensor and

Dear Alumni and Alumni Coordinators of USG-funded Programs, . We are currently preparing to publish the third edition of the newsletterof the Professionals for Cooperation Alumni Association "PFC Newsletter". ... Please send your articles along with photographs via e-mail by September 1, 2005. Sshirob@omsk.edu , Sshirob@yahoo.com ) . In addition, we would like to thank all of you who showed an interest in our presentation during the 2nd Annual U.S.-Russia Exchanges Symposium. ...

Еще в разделе: (Показать все результаты (>97) - www.prof.msu.ru/ )

• About the importance of founding teleecommunication centres in developing areas
• NGOs: The Carriers of Globalization?
• THE ROLE OF THE MASS MEDIA IN THE US FOREIGN POLICYMAKING PROCESS

THE JOURNAL OF CHEMICAL PHYSICS 136, 034902 ( 2012 ) Electrostatic interaction of neutral semi-permeable membranes Olga I. Vinogradova,1,2 , and Vladimir Lobaskin6 1 a) Lyderic Bocquet,3 Ar tem N. Bogdanov,1 Roumen Tsekov,4,5 A. N. Frumkin Institute ... This gives rise to a distance-dependent membrane potential, which translates into a repulsive electrostatic disjoining pressure. ... Phys. 136, 034902 (2012) interacting semi-permeable membranes. ... The membranes are located at |x| = h/2. ...

Еще в разделе: (Показать все результаты (>30) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/JCP2014-2.pdf
• http://nanofluidics.phys.msu.ru/paper/pre2012_1.pdf
• http://nanofluidics.phys.msu.ru/paper/prl2010_2.pdf

... Vol. ... Translated from Biofizika; Vol. ... CELL BIOPHYSICS Effects of Electric Field on Spatiotemporal Patterning in the Reaction-Diffusion System A. I. Lobanov-, T. Yu. ... Abstract-A model is proposed that describes electrodiffusion in the layer adjacent to the cell membrane. The model takes into account chemical reactions at the membrane, Coulomb interactions between particles, their random motion (diffusion), and the effect of an external electric field. ... BIOPHYSICS Vol. ...

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3340.pdf
• http://library.biophys.msu.ru/matorin/3371.pdf
• http://library.biophys.msu.ru/PDF/3344.pdf

ВМиК-Online! ... Факультет . ... Абитуриенты . ... Вариант письменного вступительного экзамена . по английскому языку . Отделение бакалавров факультета ВМиК . ... They found that cannabis users are 40 percent less effective in fighting viruses than normal people. ... Группа В Контакте для абитуриентов ВМК МГУ: . Поступление на ВМК МГУ 2012 . Форум абитуриентов ВМК МГУ . ... Телефон приемной комиссии факультета ВМиК МГУ: . ... 2001 2012 ВМиК Online! ...

Еще в разделе: (Показать все результаты (>6) - www.cmc-online.ru/ )

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>91) - npidb.belozersky.msu.ru/ )

• NPIDB: 5DPK structure

... OLYMPIAD of NSC. This letter contains information about scientific contest - Olympiad, which is held yearly in Chernogolovka: a small pictures- que village not far from Moscow, in which the Noginsk Scientific Center (NSC) of the Russian Academy of sciences is situated. The contest is participated by pupils of the 8-th to the 11-th forms and consists in solving problems in physics, astronomy and mathema- tics. The Olympiad is one of interesting traditions of our scienti- fic centre. ...

Еще в разделе: (Показать все результаты (>11) - www.issp.ac.ru/ )

• Comet Observation Home Page (Chernogolovka)
• When, Where, and How to See Comet Hale-Bopp

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/insilicobiol_2003.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>4) - www.sciencepark.ru/ )

• MSU Science Park - About us
• MSU Science Park - Services

WERE HITTITE KINGS DIVINELY ANOINTED? ... This is the only clear evidence that the gods were thought to be personally responsible for the anointment of Hittite kings. ... I am arguing that anointment with oil was extended to both Hittite priestly kings and certain other categories of Hittite priests, and that the underlying purpose of this act was ritual cleansing. ... Its beginning is preserved in two mutually complementing parallel versions KUB 35.165 Obv. ... the priest, son of the king'. ...

Еще в разделе: (Показать все результаты (>14) - imk.msu.ru/ )

• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/luwian.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/sippanti.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/ENEMY.pdf

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>19) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/INFN%20-%20Paper%201.pdf
• http://antares.sinp.msu.ru/docs/Ershova%20-%20Acoustic%20field%20eng.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20Paper%202.pdf

... Магистерское образование . ... Enterprise Information Infrastructure . This course is focused on enterprise infrastructure and integration technology. Course presents different approaches to enterprise architecture and modern solutions of information infrastructure problems. Course?s topics cover strategies that help large enterprises to increase the agility of their IT systems. ... Enterprise portal technology, including collaboration and knowledge management . ... FI- Master data . ...

Еще в разделе: (Показать все результаты (>15) - hcs.cmc.msu.ru/ )

• Mathematical models and methods in VLSI design | Магистерское и послевузовское
• Mathematical Models of Complex Systems: Theory, Algorithms, Applications |

The laboratory is engaged in fabricating high-efficiency catalysts and working out theoretical descriptions of kinetics and mechanisms of the processes which takes place in chemical power sources. ... The kinetics of electrooxidation of some simplest organic fuels is investigated, which is of interest for electrochemical generators. ... B.I.Podlovchenko, E.A.Kolyadko, Lu Shigan, Specific Features of Hydrogen Sorption by Pd Dispersed Forms at a-Phase Potentials // J.Electroanal. ...

Еще в разделе: (Показать все результаты (>11) - www.elch.chem.msu.ru/ )

Fluctuation in EAS development and estimates of energy and composition of the primary radiation by L. Dedenko, SINP, MSU 1) surface scintillation detectors (SD) 2) detectors of the Vavilov-Cherenkov radiation (VCR) 3) underground detectors of muons (UD) (with the threshold energy ~1 GeV). Yakutsk array Detectors readings Ї The various particles Ї of Extensive Air Showers (EAS) Ї at the observation level Ї hit detectors Ї and induce some signals sampled as Ї detector readings 18.05.2011. IWS. ...

Еще в разделе: (Показать все результаты (>8) - tunka.sinp.msu.ru/ )

• http://tunka.sinp.msu.ru/en/presentation/Shpiering.pdf
• http://tunka.sinp.msu.ru/en/presentation/horns_vhe.pdf