... Другие названия журнала: Biochim Biophys Acta - Proteins and Proteomics , Biochimica Et Biophysica Acta-Proteins and Proteomics , Biochimica et biophysica acta, Proteins and Proteomics . ... Solovjeva O.N. , Kovina M.V. , Kochetov G.A. в журнале Biochimica et Biophysica Acta - Proteins and Proteomics , издательство Elsevier BV (Netherlands) , том 1864, ? ... в журнале Biochimica et Biophysica Acta - Proteins and Proteomics , издательство Elsevier BV (Netherlands) , ? ...

Еще в разделе: (Показать все результаты (>26028) - istina.msu.ru/ )

• Protein and Peptide Letters - журнал | ИСТИНА - Интеллектуальная Система
• Current Protein and Peptide Science - журнал | ИСТИНА - Интеллектуальная
• Biochimie - журнал | ИСТИНА - Интеллектуальная Система Тематического

... The Protein Journal [Prot Jour] . Common information . ... since 1982-05-01 till today . ... biology ->biochemistry ->proteins . ... Was renamed in 2004 from [Journal of Protein Chemistry]. ... http://www.springer.com/journal/10930.. ... http://elibrary.ru/title_about.asp?id.. ... toc, abstract . http://www.springerlink.com/content/1... 1998-01-01 . ... full-text . http://elibrary.ru/issues.asp?id=1490 . ... abstract, full-text, toc . http://www.springerlink.com/content/1.. ...

Еще в разделе: (Показать все результаты (>518) - journals.genebee.msu.ru/ )

• JCatalog - Список журналов
• JCatalog journal list

. Album : asv-album :: Travels to distant places and countries ::2013/06 Eindhoven, Amsterdam (Netherlands) . Up . Folders : . Amsterdam . Amsterdam - Rembrandthuis . Amsterdam - Rijksmuseum . Amsterdam - Sexmuseum . BOSCH . Concert . Eindhoven . Eindhoven - Philips museum . Eindhoven - St Catarina . Illusionists . misc . Moscow - Amsterdam . Photo album generated by album from Dave Madison 's Marginal Hacks on Sun Jun 28 19:54:54 2015 .

Еще в разделе: (Показать все результаты (>1133) - crydee.sai.msu.ru/ )

• Album: 1994/08 Hague, Amsterdam, Rotterdam (Netherlands)
• Album: 2004/06 Leiden, Hague, Amsterdam (Netherlands)
• Album: Travels to distant places and countries

... Fifteenth-century northern artists did not intensively cultivate classical sources, nor did they show the predilection for abstract and theoretical systems of representation that characterized Italian art. ... Jan van EYCK , the supreme master of the Netherlandish school, is recognized as having been the first to exploit the full potential of the new medium of oil painting. ... More in keeping with the Renaissance spirit are the works of Hugo van der Goes , who was active in Ghent and Bruges. ...

Еще в разделе: (Показать все результаты (>124) - www.sai.msu.su/ )

• SUN's references

Name Last modified Size Description . Parent Directory - amsterdam1.jpg 29-Mar-2011 12:18 562K amsterdam2.jpg 29-Mar-2011 12:17 1.4M amsterdam3.jpg 29-Mar-2011 12:17 555K maastricht.jpg 29-Mar-2011 12:17 593K . Apache/2.2.10 (Linux/SUSE) Server at higeom.math.msu.su Port 80

Еще в разделе: (Показать все результаты (>10) - higeom.math.msu.su/ )

Электронная библиотека Попечительского совета . ... Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . ... Marran J.F. - The Netherlands . Читать книгу . ... Скачать книгу с нашего сайта нельзя . Обсудите книгу на . ... Название: The Netherlands . Автор: Marran J.F. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>814) - lib.mexmat.ru/ )

• Sicking L. - Neptune and the Netherlands: State, Economy, and War at Sea in the
• The Concrete Societies of The UK, The Netherlands and Germany - Design Aids for
• van der Bliek J.A. - 75 Years of Aerospace Research in the Netherlands. 1919 -

... Academic Departments . ... Partners . ... All partners . ... 22.02.2014 On February 21, 2014 lector Jan Rietman (Hogeschool Windesheim, the Netherlands) delivered a lecture within the frames of the Master degree course Current Issues in the Mass Media . ...

Еще в разделе: (Показать все результаты (>19) - www.journ.msu.ru/ )

• The students of the Faculty of Journalism visited the Saxion University ::

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Is here some one from Netherlands? ... In this letter there will be an important information and if you or your fellows in Netherlands could recieve and tell me about it. ...

Еще в разделе: (Показать все результаты (>412) - www.fds-net.ru/ )

• PhD position in Computer Science, Leiden University, The Netherlands - Public

Fast evolution of a conserved residue of polyomaviruses defines a new mechanism of adaptation that operates by accelerated codon-constrained Val-Ala ( COCO-VA ) toggling within an intrinsically disordered protein region Chris Lauber1,2, Siamaque Kazem1, Alexander A. Kravchenko3+, Els van der Meijden1, Sander Kooijman1, Mariet C.W. Feltkamp1, and Alexander E. Gorbalenya1,3,4* 1 Department of Medical Microbiology, Leiden University ...

Еще в разделе: (Показать все результаты (>192) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/181.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/196.pdf

... Dr. G. Koptsik . ... Aim of this project is to develop a tool to quantify the risks of excess inputs of heavy metals to agricultural and forest ecosystems. ... Geographically the accent will be put on agricultural and forest ecosystems of the Northern (Kola Peninsula) and Central (Upper Oka-river basin) parts of Russia. ... Koptsik G.N., Nalbandyan K.F. 2002. ... Koptsik, S., Koptsik, G., and Eruslankina, L. Heavy metals in subarctic forest ecosystems: soil pollution and impacts on plant diversity. ...

Еще в разделе: (Показать все результаты (>6) - eco.soil.msu.ru/ )

• Polluting metals in Russian terrestrial ecosystems: chemistry, dynamics, and

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>14) - npidb.belozersky.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>17) - mouse.genebee.msu.ru/ )

• Comparison of protein phylogeny reconstruction methods
• ConClus

Список сообщений на конференциях. ... Gallyamov M.O., Kiselyova O.I ., Tuzov I., Ivanov Yu.D., Yaminsky I.V., . ... Uvarov V.Y., Romanov A.N., Gallyaov M.O., Kiselyova O.I., Yaminsky I.V., . ... Ivanov Yu.D., Uvarov V.Y., Romanov A.N., Gallyaov M.O., Kiselyova O.I., Yaminsky I.V., . ... Gallyamov M.O., Ivanov Y.D., Kiselyova O.I., Uvarov V.Y., Yaminsky I.V., . ... Yu.D. Ivanov , S.A. Usanov, O.I. Kiselyova, I.V. Yaminsky, V.A. Bykov, A.I. Archakov, . ... Kiselyova O.I., Frolova O.Yu., ...

Еще в разделе: (Показать все результаты (>47) - www.spm.genebee.msu.ru/ )

• Proteins and membranes
• INTAS-01-0045
• AFM OF RNA AND RNA-PROTEINS COMPLEXES

... PhD in Public Administration, post-doctoral scholar, Department of Public Policy and Political Process Management, President of Ukraine National Academy of Public Administration; Head of the board of directors, Ukrainian Evaluation Association. ... Evaluation systems in the USA, Canada, the Netherlands and the United Kingdom are examples of advanced evaluation models which explore different options for evaluation capacity development. ... Program evaluation, evaluation of public policy. ...

Еще в разделе: (Показать все результаты (>3) - ee-journal.spa.msu.ru/ )

. ISSN 0028-2944 . Год: Том (Номера) / Year: Volume (Numbers) . 1993: 99(1,2,3,4,5-6,SUP 1,SUP 2,SUP 3) . 1992: 98(1,2,3,4,5,6,SUP 1,SUP 2) . 1991: 97(1,2,3,4,5,6) . 1990: 96(1,1 SUP,2,3,4,5,6) .

Еще в разделе: (Показать все результаты (>262) - www.sevin.ru/ )

• ОБН РАН. Каталог журналов

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>6110) - monkey.belozersky.msu.ru/ )

• SCOP famyli: Replication terminator protein (Tus)
• SCOP famyli: Prokaryotic DNA-bending protein
• SCOP famyli: DNA repair protein MutS, domain I

Таблица 4. Изменение числа документов . по материалам разделительного слоя мембран . ... материалы . ... Всего документов . ... Peop. Rep. China . Germany . Japan . Netherlands . S. Korea . ... Не разрешается копирование материалов и размещение на других Web-сайтах . ...

Еще в разделе: (Показать все результаты (>348) - chem.msu.ru/ )

• Laboratory of structural chemistry
• Laboratory of protein chemistry
• Лаборатория химии поверхности - ПУБЛИКАЦИИ ПОСЛЕДНИХ ЛЕТ

... Первое направление исследований направлено на изучение структуры и свойств белков, участвующих в регуляции сократительной активности различных типов мышц. ... Охарактеризованы протеинкиназы, обеспечивающие фосфорилирование кальдесмона и кальпонина, и изучены Са-связывающие белки, участвующие в регуляции сократительной активности гладких мышц. ... Получены рекомбинантные малые белки теплового шока человека HspB1, HspB5, HspB6, HspB8, охарактеризована их структура и шапероноподобная активность. ...

Еще в разделе: (Показать все результаты (>264) - biochem.bio.msu.ru/ )

• Protection of proteins from oxidative stress: a new illusion or a novel
• Erythrocyte and plasma protein modification in alcoholism: a possible role of
• A protein whose binding to Na,K-ATPase is regulated by ouabain.

... PYRB_ECOLI 51 EASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYV 100 PYRB_VIBCH 101 DAFVMRHPQEGAARLASEFSNGVPVINAGDGSNQHPSQTLLDLYSIFETQ 150 || PYRB_ECOLI 101 DAIVMRHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQETQ 150 PYRB_VIBCH 151 GRLDNLDVAFVGDLKYGRTVHSLAQALAKFDNNRFYFVAPEALAMPDYIC 200 || PYRB_ECOLI 151 GRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYIL 200 PYRB_VIBCH 201 EELDEAGVKYQVFSDMESVIPELDILYMTRVQKERFDESEYAHIKSAYIL 250 :.| ...

Еще в разделе: (Показать все результаты (>14462) - kodomo.fbb.msu.ru/ )

• allpy: 4a9b4503a027 allpy/protein.py
• allpy: faa7e19bffd9 allpy/protein.py
• allpy: b556c96c6719 allpy/protein.py

Group "Biomedical applications for proteins and enzymes. Pharma Biotechnology" . ... Associate Professor Babusenko E.S. (Protein encapsulation) http://www.muctr.ru/univsubs/infacol/ekolog/faculties/f3 . ... Professor Shvetz V.I. , associate Professor Sorokoumova G.M. (Lipid- based protein delivery systems) http://www.mitht.ru . ... Scryabin Moscow Academy of Veterinary Medicine and Biotechnology, Professor Belousova R.V. (Antiviral action of protein preparations) http://www.mgavm.ru . ...

Еще в разделе: (Показать все результаты (>146) - www.enzyme.chem.msu.ru/ )

• proj_past
• Genetic and Protein Engineering Group
• Members of Genetic and Protein Engineering Group