... 9 container is iterable collection of items. 10 item is object getting markup data (new attribute). 11 . ... 32 def __init__ ( self , name , container , map_out = {}): . ... 40 def set_map_out ( self , map_out ): . ... 44 def set_map_in ( self , map_in ): . ... 54 def __getitem__ ( self , item ): . ... 65 def __contains__ ( self , item ): . ... 88 def from_string ( cls , string , name , container , map_out = {}): . ... 94 self = cls ( name , container , map_out ) . ... 103 def items ( self ): . ...

Еще в разделе: (Показать все результаты (>112843) - kodomo.fbb.msu.ru/ )

• allpy: b2ec17578145
• allpy: 9c00d065c054 allpy/util.py
• allpy: 9c00d065c054 NEWS

... Previous Changeset . Next Changeset . ... Show lines around each change . ... Added Cell attribute snake_type to snake.Rule pattern cells . ... assert line == '', "Rules must be separated by empty lines" ?а . ... assert char.lower() in self.codes, "Illegal symbol in rule: %s" % char ?а . ... cell.snake = 'my' ?а . ... cell.snake _type = 'my' ?а . ... cell.snake = 'enemy' ?а . ... cell.snake _type = 'enemy' ?а . ... assert (x, y) == (3, 3), "Own head must in the center of rule" ?а . ...

Еще в разделе: (Показать все результаты (>4404) - kodomo.cmm.msu.ru/ )

• Changeset 44:a7e53eb3f54d ? Python Battle
• TracChangeset тАУ Tanchiki
• Changeset 28:4ef6336d1707 тАУ Tanchiki

... Is only visible when cellspacing is larger than 1, or cellborder is 0 , or tablerules is none , otherwise the cell borders overlap the table border. unspecified . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). ... unspecified . ... This topic: System > Plugins > TablePlugin > VarTABLE...

Еще в разделе: (Показать все результаты (>3789) - wiki.cmc.msu.ru/ )

... Vertical alignment of header cells; overrides valign . unspecified . ... Vertical alignment of cells and headers, set to "top" , "middle" , "bottom" or "baseline" . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). unspecified . ... Header cell text colour. "#ffffff" . ...

Еще в разделе: (Показать все результаты (>28823) - dualopt1.cmm.msu.ru/ )

• VarTABLE - TWiki - TWiki - (printable)
• VarTABLE - TWiki - TWiki

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>52) - uneex.mithril.cs.msu.su/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>191) - uneex.lorien.cs.msu.su/ )

... Content Model: Table Cells (TH or TD) . The TR element acts as a container for a row of table cells defined with the TH or TD elements. ... You also have the ability to disable word wrap for the row, and thereafter use the <BR> element to determine line breaks and hence cell widths. ... The recommended approach is to subclass rows using the CLASS attribute For example: <TABLE BORDER COLSPEC= .. ... ALIGN . ... This is used when you want to ensure that all cells in the row share the same baseline. ...

Еще в разделе: (Показать все результаты (>70) - comet.sai.msu.ru/ )

• Paragraphs
• Horizontal Tabs
• Preformatted Text

previous next contents elements attributes . ... Changes to elements . New elements . ... The new elements in this version of HTML are Q , INS , DEL , ACRONYM , LEGEND , COLGROUP , BUTTON , and FIELDSET . ... These changes were additionally motivated by the desire to avoid future problems if this specification is extended to allow frame and rules attributes with other table elements. ... To solve these problems this specification introduces several new attributes and elements. ...

Еще в разделе: (Показать все результаты (>182) - itpm.msu.su/ )

• Alignment, font styles, and horizontal rules in HTML documents
• HTML 4.0 Specification
• Definitions and Conventions

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search

Электронная библиотека Попечительского совета . ... Eckstein R., Spainhour S. - Webmaster in a Nutshell . ... Название: Webmaster in a Nutshell . Авторы: Eckstein R., Spainhour S. Аннотация: . Webmaster in a Nutshell is a concise and portable quick reference guide that distills an immense amount of information on several languages and technologies into one compact book. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>3678) - lib.mexmat.ru/ )

• Dubinko M. - XForms Essentials :: Электронная библиотека попечительского совета
• Mangano S. - XSLT Cookbook :: Электронная библиотека попечительского совета
• Robbins J.N. - Web Design in a Nutshell :: Электронная библиотека

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6976) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>125) - www.genebee.msu.ru/ )

• Screening of pattern or alignment against PROTEIN databank
• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced

... int hw_modifyobject ( int connection, int object_to_change, array remove, array add, int mode) . This command allows to remove, add, or modify individual attributes of an object record. ... In order to modify an attribute one will have to remove the old one and add a new one. hw_modifyobject() will always remove the attributes before it adds attributes unless the value of the attribute to remove is not a string or array. ... The keys of both arrays are the attributes name. ...

Еще в разделе: (Показать все результаты (>218) - oit.cmc.msu.ru/ )

• ldap_mod_add
• ldap_get_attributes
• ldap_first_attribute

previous next contents elements attributes index . ... Alignment . ... Font style elements: the TT , I , B , BIG , SMALL , STRIKE , S , and U elements . ... This attribute specifies the horizontal alignment of its element with respect to the surrounding context. ... You could reduce the scope of the style by setting the class attribute on the element: <HEAD> <TITLE>How to Carve Wood</TITLE> <STYLE type="text/css"> H1.wood {text-align: center} </STYLE> <BODY> <H1 class="wood"> How to Carve Wood </H1> . ...

Еще в разделе: (Показать все результаты (>619) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• HTML 4.0 Specification
• Index of the HTML 4.0 Attributes

SVETKA, a program for analysis of different alignments . Back to the help page . ... Such a feature can look like " Leucine in the position 362 of the alignment of the entire family " and can, in many cases, be a "decision rule" to distinguish sequences from two sides of a tree branch. ... Comparing the alignment with an input tree (the tree may be entered by the user or reconstructed with the WPGMA algorithm), the program detects supporting positions of the alignment for every branch the tree. ...

Еще в разделе: (Показать все результаты (>275) - monkey.belozersky.msu.ru/ )

• SDP home page
• ETS_all_contacts alignment
• Inquiry information || Formats of alignments

... Attributes . ... This requires that attributes be tagged either as ``C,'' ``C++'' or ``Fortran,'' and that the language tag be checked in order to use the right calling convention for the callback function. ... The attribute manipulation functions described in Section 5.7 of the MPI-1 standard define attributes arguments to be of type void* in C, and of type INTEGER, in Fortran. ... Fortran attribute functions put and get integer valued attributes. ... A. C to Fortran . ... Fortran code . ... Центры...

Еще в разделе: (Показать все результаты (>288) - www.parallel.ru/ )

• Window Attributes | PARALLEL.RU - Информационно-аналитический центр по
• Clarification of Error Behavior of Attribute Callback Functions | PARALLEL.RU -
• New Attribute Caching Functions | PARALLEL.RU - Информационно-аналитический

... public class Attribute . ... They have a name, type and an array of values. ... Attribute (java.lang.String name, double value) . ... If the value represents an array type, returns the Class object representing the component type of the array; otherwise returns null. int . ... Constructor Detail public Attribute (java.lang.String name, java.lang.Number value) . ... public Attribute (java.lang.String name, double value) . ... public Attribute (java.lang.String name, java.lang.Object theValue) . ...

Еще в разделе: (Показать все результаты (>52) - angel.cs.msu.su/ )

• : Interface AttributeSet
• : Class ProtoVariable
• : Class Schema

Network Working Group Request for Comments: 1464 R. Rosenbaum Digital Equipment Corporation May 1993 Using the Domain Name System To Store Arbitrary String Attributes Status of this Memo This memo defines an Experimental Protocol for the Internet community. ... Abstract While the Domain Name System (DNS) [2,3] is generally used to store predefined types of information (e.g., addresses of hosts), it is possible to use it to store information that has not been previously classified. ...

Еще в разделе: (Показать все результаты (>13236) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1464.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc1026.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1026.txt

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

NPG-explorer : a new tool for nucleotide pangenome construction and closely related prokaryotic genomes analysis Boris Nagaev2, Maxim Nikolaev2, Andrei Alexeevski 1 1,2,3* A.N.Belozersky Institute Of Physico-Chemical Biology and 2Faculty ... @gmail.com Moscow State University, Moscow 119991, Russia 3Scientific Research Institute of System Analysis (NIISI RAS), Moscow Genomes of closely related bacteria have highly similar sequences of orthologous ... Blocks are classified into four categories. ...

Еще в разделе: (Показать все результаты (>110) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/4.pdf