... 9 container is iterable collection of items. 10 item is object getting markup data (new attribute). 11 . ... 32 def __init__ ( self , name , container , map_out = {}): . ... 40 def set_map_out ( self , map_out ): . ... 44 def set_map_in ( self , map_in ): . ... 54 def __getitem__ ( self , item ): . ... 65 def __contains__ ( self , item ): . ... 88 def from_string ( cls , string , name , container , map_out = {}): . ... 94 self = cls ( name , container , map_out ) . ... 103 def items ( self ): . ...

Еще в разделе: (Показать все результаты (>59177) - kodomo.fbb.msu.ru/ )

• allpy: 19ffcf1ac4a0 allpy/markup.py
• allpy: d9a3e99ae19b allpy/markup.py
• allpy: f3358da68bcd allpy/markup.py

... Content Model: Table Cells (TH or TD) . The TR element acts as a container for a row of table cells defined with the TH or TD elements. ... You also have the ability to disable word wrap for the row, and thereafter use the <BR> element to determine line breaks and hence cell widths. ... The recommended approach is to subclass rows using the CLASS attribute For example: <TABLE BORDER COLSPEC= .. ... ALIGN . ... This is used when you want to ensure that all cells in the row share the same baseline. ...

Еще в разделе: (Показать все результаты (>256) - comet.sai.msu.ru/ )

• Divisions
• HTML Math
• Paragraphs

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Jan-25 18:25:05 . 2.4K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 0.8K . application/octet-stream . Manifest . 2016-Jan-25 18:25:05 . 1.8K . application/octet-stream . data-default-instances-containers-0.0.1.ebuild . 2015-Aug-09 03:38:18 . 0.6K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.3K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>24855) - mirror.msu.net/ )

Электронная библиотека Попечительского совета . ... Walrath K., Campione M., Huml A. - JFC Swing Tutorial, The: A Guide to Constructing GUIs . ... Название: JFC Swing Tutorial, The: A Guide to Constructing GUIs . Авторы: Walrath K., Campione M., Huml A. Аннотация: . ... The JFC Swing Tutorial: A Guide to Constructing GUIs provides a hard copy of Sun's popular online tutorial for Swing/JFC development. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8160) - lib.mexmat.ru/ )

• Ray E. - Learning XML :: Электронная библиотека попечительского совета мехмата
• van der Vlist E. - Relax NG :: Электронная библиотека попечительского совета
• Harold E.S., Means W.S. - XML in a Nutshell :: Электронная библиотека

... To run the <LAYER> version of the example, select: flower.htm . ... However, if the page had several layers with absolute positions, and you wanted to place another layer in a relative position to one of the existing layers, you could use inline JavaScript to calculate the value for LEFT or TOP . ... In this example, there is really no need to use inline JavaScript to position the last flower layer, since you could just let the TOP value default to its natural value, as in the other flower layers. ...

Еще в разделе: (Показать все результаты (>1882) - crydee.sai.msu.ru/ )

• Property index
• SGML reference information for HTML
• Keyword arguments and default arguments

... Note that if the contents contains block elements such as div , mode should be div as well to create valid HTML markup. optional, defaults to <div> . ... hide" . ... Class for link . ... Image url . ... Alternatively use an image attached to the topic. optional, defaults to no image . ... Specify the url of an image that will be displayed with the hide link at the left side of the link. ... Specify the url of an image that will be displayed with the hide link at the right side of the link. ... link ...

Еще в разделе: (Показать все результаты (>7290) - wiki.cmc.msu.ru/ )

• WysiwygPluginSettings < System < Foswiki
• PerlDoc < System < Foswiki
• JQueryShrinkUrls < System < Foswiki

Each Apache configuration directive is described using a common format that looks like this: . Syntax: directive-name some args . ... Context: context-list . ... If the directive has a default value ( i.e. , if you omit it from your configuration entirely, the Apache Web server will behave as though you set it to a particular value), it is described here. ... A directive marked as being valid in this context may be used inside <Directory> containers in the server configuration files.htaccess . ...

Еще в разделе: (Показать все результаты (>894) - oit.cmc.msu.ru/ )

• xml_set_default_handler
• Declaration of the Zend Function Block
• Servers-Netscape and iPlanet

Лаборатория концентрирования, общая информация . ... общих вопросов аналитической химии (история, терминология, география, кадры, популяризация и др.; академик Ю.А. Золотов); . сорбционного концентрирования элементов, органических соединений и поиска новых сорбентов (группы д.х.н. Г.И. Цизина, д.х.н. С.Г. Дмитриенко, д.х.н. Е.И. Моросановой); . разработки экспрессных тест-методов химического анализа, главным образом вне лаборатории (группы д.х.н. Е.И. Моросановой, д.х.н С.Г. Дмитриенко); . ...

Еще в разделе: (Показать все результаты (>28) - analyt.chem.msu.ru/ )

... TWikiAttrsDotPm . Class of attribute sets, designed for parsing and storing attribute values from a TWiki tag e.g. %TAG{"joe" fred="bad" joe="mad"}% . ... The default parameter (unnamed quoted string) is named _DEFAULT in the hash. ... As well as the default TWiki syntax (parameter values double-quoted) this class also parses single-quoted values, unquoted spaceless values, spaces around the =, and commas as well as spaces separating values. ... remove ObjectMethod remove ($key) -> $value . ...

Еще в разделе: (Показать все результаты (>41147) - dualopt1.cmm.msu.ru/ )

• TWikiAttrsDotPm - TWiki - TWiki - (printable)
• WebSearchAdvanced - _default - TWiki
• WebSearch - _default - TWiki

... Foswiki::Search::InfoCache - Support package; cache of topic info. ... ObjectMethod finish() . ObjectMethod metacache . ... If _callback is set, that means the caller wants results as soon as they are ready. =_callback_ should be set to a reference to a function which takes _cbdata as the first parameter and remaining parameters the same as 'print'. ... Note: If format is set, template will be ignored. ... This topic: System > WebHome > ReferenceManual > DeveloperDocumentationCategory > PerlDoc . ...

Еще в разделе: (Показать все результаты (>2376) - wiki.cs.msu.ru/ )

• VarTWISTY < System < Foswiki
• TopicsAndWebs < System < Foswiki
• WebRssBase < System < Foswiki

Each Apache configuration directive is described using a common format that looks like this: . ... This indicates the format of the directive as it would appear in a configuration file. This syntax is extremely directive-specific, and is described in detail in the directive's definition. ... If the directive has a default value ( i.e. , if you omit it from your configuration entirely, the Apache Web server will behave as though you set it to a particular value), it is described here. ...

Еще в разделе: (Показать все результаты (>114) - neptun.sai.msu.ru/ )

• Manual Page: ab - Apache HTTP Server
• Apache module mod_log_common
• Apache module mod_dld

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>24) - mouse.genebee.msu.ru/ )

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ... ab is a tool for benchmarking your Apache Hypertext Transfer Protocol (HTTP) server. ... This especially shows you how many requests per second your Apache installation is capable of serving. ... The default is to just perform a single request which usually leads to non-representative benchmarking results. -p POST-file . ... Use a proxy server for the requests. -y <tr>-attributes . ...

Еще в разделе: (Показать все результаты (>499) - itpm.msu.su/ )

• Terms Used to Describe Directives - Apache HTTP Server
• Using Options Files
• mod_auth_dbm - Apache HTTP Server

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ab is a tool for benchmarking your Apache Hypertext Transfer Protocol (HTTP) server. ... This especially shows you how many requests per second your Apache installation is capable of serving. ... The default is to just perform a single request which usually leads to non-representative benchmarking results. -p POST-file . ... Use a proxy server for the requests. -y <tr>-attributes . ...

Еще в разделе: (Показать все результаты (>647) - uneex.lorien.cs.msu.su/ )

• Terms Used to Describe Directives - Apache HTTP Server
• mod_auth_dbm - Apache HTTP Server
• VirtualHost Examples - Apache HTTP Server

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>176) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Fasta3 help

This module is contained in the mod_setenvif.c file, and is compiled in by default. It provides for the ability to set environment variables based upon attributes of the request. The mod_setenvif module allows you to set environment variables according to whether different aspects of the request match regular expressions you specify. ... Module: mod_setenvif . Compatibility: Apache 1.2 and above (in Apache 1.2 this directive was found in the now-obsolete mod_browser module) . ...

Еще в разделе: (Показать все результаты (>660) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_auth_dbm
• Apache module mod_cgi
• Apache module mod_so

NPG-explorer : a new tool for nucleotide pangenome construction and closely related prokaryotic genomes analysis Boris Nagaev2, Maxim Nikolaev2, Andrei Alexeevski 1 1,2,3* A.N.Belozersky Institute Of Physico-Chemical Biology and 2Faculty ... @gmail.com Moscow State University, Moscow 119991, Russia 3Scientific Research Institute of System Analysis (NIISI RAS), Moscow Genomes of closely related bacteria have highly similar sequences of orthologous ... Blocks are classified into four categories. ...

Еще в разделе: (Показать все результаты (>171) - mccmb.belozersky.msu.ru/ )

psrose - Plot (length, azimuth ) as windrose diagram or polar histogram ( sector or rose diagram ). psrose file [ -A sector _ width [ r ] ] [ -B tickinfo ] [ -C [ mode - file ] ] [ -E azimuth / elevation ] [ -G fill ] [ -H [ nrec ] ] [ -I ] [ -K ] [ -M [ parameters ] [ -O ] [ -P ] [ -R r0 / r1 / az _ 0 / az _ 1 ] [ -S ... Default 0 means windrose diagram]. ... Default is 1] -: Input file has (azimuth,radius) pairs rather than the expected (radius,azimuth). -bi Selects binary input. ...

Еще в разделе: (Показать все результаты (>214) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/grdvector.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmode.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmedian.html

... The RPS-BLAST database must be prepared again for the small-endian system. ... Primary preprocessing Prepare the following files : i. a collection of PSI- BLAST -generated profiles with arbitrary names and suffix .chk; ii. a collection of profile master sequences , associated with the profiles , each in a separate file with arbitrary name and a 3 character suffix starting with c; the sequences can have deflines; they need not be sequences in nr or in any other sequence ...

Еще в разделе: (Показать все результаты (>6431) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/impala.html
• http://kodomo.cmm.msu.su/trac/tanchiki/wiki/WikiHtml?format=txt
• WikiHtml тАУ Tanchiki

Apache2 Ubuntu Default Page . It works! This is the default welcome page used to test the correct operation of the Apache2 server after installation on Ubuntu systems. ... Ubuntu's Apache2 default configuration is different from the upstream default configuration, and split into several files optimized for interaction with Ubuntu tools. ... The configuration layout for an Apache2 web server installation on Ubuntu systems is as follows: /etc/apache2/ |-- apache2.conf | ... Document Roots . ...