... See #95 1) Sequences, Alignment and Blocks now have two new methods: - add_markup(name, markup_class=optional, **kwargs=optional) - remove_markup(name) name refers to the same name as in aln.markups[name] or sequence[i].name It is now explicitly denied to create markups any other way. ... For sequences markups it removes markup attribute from each monomer. 3) Added necessary del sequence_markup[monomer] method. ... add_markup ( name , markup_class = cls ) . ... 39 def to_record ( self ): . ...

Еще в разделе: (Показать все результаты (>46871) - kodomo.fbb.msu.ru/ )

• allpy: allpy/base.py diff
• allpy: 116f5bfc39b8
• allpy: 3a712982ceb8 allpy/markups.py

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>1830) - monkey.belozersky.msu.ru/ )

• About this project
• SDPpred
• About COGs

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>176) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPpred
• Site Cluster

... List of solitary restriction endonucleases in complete prokaryotic genomes . List of groups of orthologous R-M systems. List of all analyzed genomes. Contains those orthologous groups that include at least one separated R-M system . R-M orthologous group ID . REs alignments . MTases alignment . Group 1 . ...

Еще в разделе: (Показать все результаты (>7050) - mouse.belozersky.msu.ru/ )

• PLANdbAffy: probe-level annotation database for Affymetrix expression
• SVETKA, a program for multiple sequence alignments analysis

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>32) - mouse.genebee.msu.ru/ )

• ConClus

... Derived datatypes . Up: Point-to-Point Communication Next: Datatype constructors Previous: Null processes . ... Instead, MPI provides mechanisms to specify more general, mixed, and noncontiguous communication buffers. ... More general communication buffers are specified by replacing the basic datatypes that have been used so far with derived datatypes that are constructed from basic datatypes using the constructors described in this section. ... A sequence of basic datatypes . ... Центры . ...

Еще в разделе: (Показать все результаты (>292) - www.parallel.ru/ )

Sequence alignment of non-superposable beta-sheets Evgeniy Aksianov Belozersky Institute, Lomonosov Moscow State University, Leninskie Gori 1, Moscow, Russia, evaksianov@gmail.com Andrey V. Alexeevski Belozersky Institute, Lomonosov Moscow State University, Scientific Research Institute for System Studies (NIISI RAN), Moscow, Russia aba@belozersky.msu.ru Protein 3D structures usually are more conserved than their sequences. ... Beta-strands are contained in sheet map rows. ...

Еще в разделе: (Показать все результаты (>265) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/197.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/19.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf

... High-scoring Sequences . ... The E-value of a sequence is the expected number of sequences in a random database of the same size that would match the motifs as well as the sequence does and is equal to the combined p-value of the sequence times the number of sequences in the database. ... Sequence Name . ... Following the description line(s) is a line giving the length, combined p-value, and E-value of the sequence as defined in Section I. The next line reproduces the motif diagram from Section II. ...

Еще в разделе: (Показать все результаты (>4975) - kodomo.cmm.msu.ru/ )

... Class . ... Nested classes inherited from class javax.swing.JApplet . ... private int . ... private java.lang.String[] . ... private static int . ... Fields inherited from class javax.swing.JApplet . ... Fields inherited from class java.applet.Applet . Fields inherited from class java.awt.Panel . Fields inherited from class java.awt.Container . Fields inherited from class java.awt.Component . ... Field Detail private static final int VERTICAL . ... private java.lang.String[] classes . ...

Еще в разделе: (Показать все результаты (>75) - angel.cs.msu.su/ )

• BackgroundTable
• DataTable
• BackgroundTableCellRenderer

... 1) Our CAS system will store the catalogues. ... Each catalogue should contain one or more tables. 2) The names of the catalogues should be unique, as well as the the names of tables of the SAME catalogue. ... 4) All the metadata about the CAS system, its tables, catalogues should reside in separate schema (currently "cas_metadata"). 1) The main system table of CAS is the table "catalog_list". ... short info (column "info") . ... 2) The second system table of CAS is the table "table_list". ...

Еще в разделе: (Показать все результаты (>1759) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - Sequin
• SAL- Other Scientific Fields - Chemistry, Biology Related - MOLPHY
• FTS operator

Электронная библиотека Попечительского совета . ... Walrath K., Campione M., Huml A. - JFC Swing Tutorial, The: A Guide to Constructing GUIs . ... Название: JFC Swing Tutorial, The: A Guide to Constructing GUIs . Авторы: Walrath K., Campione M., Huml A. Аннотация: . ... The JFC Swing Tutorial: A Guide to Constructing GUIs provides a hard copy of Sun's popular online tutorial for Swing/JFC development. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>7923) - lib.mexmat.ru/ )

• Althaus E. - A branch-and-cut algorithm for multiple sequence alignment ::
• Korf I., Yandell M., Bedell J. - Blast (Basic Local Alignment Search Tool) ::
• Kim K.H., G?nther H.-O. - Container Terminals and Cargo Systems: Design,

... 3.0.4 - 3.0.18 only, PHP 4 >= 4.0.0) imap_fetch_overview -- Read an overview of the information in the headers of the given message . array imap_fetch_overview ( int imap_stream, string sequence [, int flags]) . ... mbox = imap_open("{your.imap.host:143}","username","password") or die("can't connect: ".imap_last_error()); $overview = imap_fetch_overview($mbox,"2,4:6",0); if(is_array($overview)) { reset($overview); while( list($key,$val) = each($overview)) { print $val->msgno . ... val->subject . ...

Еще в разделе: (Показать все результаты (>548) - oit.cmc.msu.ru/ )

• odbc_tables
• imap_mail_move
• odbc_columns

Permitted Context: %math . ... This is represented in HTML math by: <array> <row><item>a_11_<item>a_12_<item> <item>a_1n_ <row><item> <item> <item> <item> <row><item>a_n1_<item>a_n2_<item> <item>a_nn_ </array> . ... This is represented by: <array coldef="C+C+C+C=C"> <row><item>a_11_x_1_<item>a_12_x_2_<item> <item>a_1n_x_n_<item>b_1_ <row><item>a_21_x_1_<item>a_22_x_2_<item> <item>a_2n_x_n_<item>b_2_ <row><item colspan=5> <row><item>a_n1_x_1_<item>a_n2_x_2_<item> <item>a_nn_x_n_<item>b_n_ </array> . ...

Еще в разделе: (Показать все результаты (>167) - comet.sai.msu.ru/ )

• Table Rows
• Removing linked directories that contain links

... DCOUNTA(database,field,criteria) . DCOUNTA function counts the cells that contain data in a database that match conditions specified. @database is a range of cells in which rows of related information are records and columns of data are fields. ... If @field is an integer, for example. 2, the second column is used. ... For example, ``Age'' refers to the column with the label ``Age'' in @database range. @criteria is the range of cells which contains the specified conditions. ... Name Age Salary . ...

Еще в разделе: (Показать все результаты (>349) - uneex.lorien.cs.msu.su/ )

• DCOUNT
• DVARP
• DSTDEV

... Line: 1 to 1 . This page is a reference for all CSS classes used in PatternSkin . ... Changed: . ... patternTopBar - top bar area .patternTopBarContents - table (for easy vertical alignment) for header art / logo; contains topic WebTopBar . ... Line: 65 to 69 .patternTopicAction - container for .patternActionButtons .patternActionButtons - action buttons at bottom of page .patternMoved - topic moved info (only visible when the topic has changed name or web) . ... patternWebIndicator - not used . ...

Еще в разделе: (Показать все результаты (>37254) - dualopt1.cmm.msu.ru/ )

• PatternSkinCss - TWiki - TWiki
• %TOPICTITLE% (2 vs. 3) - TWiki
• VarSEARCH - TWiki - TWiki - (printable)

commands.conf * # A file defining commands to be run on files, roughly based on vdr's original commands.conf syntax: # Columns are separated by colons, first column is the name of the command. ... The second column contains a filename pattern, that you only see commands useful in current context. ... If no file is # marked, current file is used # %M: the same as %m, but this will change some time - don't use it # %%: % # %:: : # # The fourth (facultative) column contains flags. ...

Еще в разделе: (Показать все результаты (>16981) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-ros/eigen_stl_containers/
• Index of /pub/gentoo-portage/dev-haskell/unordered-containers/
• Index of /pub/gentoo-portage/dev-haskell/mutable-containers/

. [ Войти ] . Главная -> Фильмы -> Container . Пользователи . Демо . Деньги . Фильмы . Форум . Container . Контейнер . Швеция 2006 . отметить . Драма . Lukas Moodysson . Mariha ?berg . Peter Lorentzon . Jena Malone .

Еще в разделе: (Показать все результаты (>15) - kinfo.ru/ )

• Commingled Containers - Фильмы - Kinfo.ru

... The numbers of three types of compact binaries containing accreting NSs and BHs, which are most interesting from the point of view of their observational appearances, have been calculated as a function of time: i) X-ray transient source containing a NS in an eccentric orbit around a main sequence Be-star (the observed prototype: A0535+26), ii) BH The evolution of the selected types of X-ray binaries during the first 10 million years after the starburst onset is presented in Fig. ...

Еще в разделе: (Показать все результаты (>200) - xray.sai.msu.ru/ )

• Be/X-ray binaries and candidates
• Post main sequence stars (stage II)

HELLU101.WAD - Hell in the University (version 1.01) A single-player level for Doom or Ultimate Doom v1.9 with some new graphics, music, sound, and monster death sequences. ... You can still play HELLU101 with 'Plain Vanilla' Doom or Ultimate Doom, but you'll need to add the extra sprite graphics to hellu101.wad using a program such as DeuSf, DeuTex, WinTex, NWT, etc. ... WAD --- All the Level "Hell in the University" was created by Lorenzo, this is the really last version of many many previous ones! ...

Еще в разделе: (Показать все результаты (>1481) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/ftproot/pub/rec/music/XG/songs/michael_walthius/GS/demons.txt
• http://crydee.sai.msu.ru/ftproot/pub/MESA-models/M7_Z002/inlist_project
• http://crydee.sai.msu.ru/ftproot/pub/MESA-models/M9_Z002/inlist_project