log . ... Thu, 10 Feb 2011 23:35:57 +0300 . boris . ... Tue, 08 Feb 2011 21:54:20 +0300 . Daniil Alexeyevsky . ... Code cleanup in allpy.base.Alignment._wipe . ... Removed trailing spaces in FASTA files produced by allpy.fasta . ... Code cleanup: removed no longer relevant comments in allpy.base . ... Mon, 07 Feb 2011 22:02:20 +0300 . ... Wed, 02 Feb 2011 17:25:03 +0300 . ... Mon, 31 Jan 2011 23:39:26 +0300 . ... Wed, 26 Jan 2011 22:25:13 +0300 . ... Tue, 25 Jan 2011 16:03:00 +0300 . ...

Еще в разделе: (Показать все результаты (>113147) - kodomo.fbb.msu.ru/ )

• allpy: 364232e42888

... Previous Changeset . Next Changeset . ... Show lines around each change . Show the changes in full context Ignore: . ... Case changes . White space changes . ... 114:793011c1119e ( diff ), 115:4cafedd51b69 ( diff ) . Note: this is a merge changeset, the changes displayed below correspond to the merge itself. Use the (diff) links above to see all the changes relative to each parent. ... cell = engine.Cell(x, y, self.snake) €а . ... cell = engine.Cell(x, y) €а . ... return False €а . ...

Еще в разделе: (Показать все результаты (>4851) - kodomo.cmm.msu.ru/ )

• Changeset 8:4f578d001608 тАУ Tanchiki
• Changeset 121:06e4b4ea7596 тАУ Python Battle
• Changeset 21:000c22d7b89c тАУ Python Battle

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6976) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>90) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee Graphical Alignment - Advanced

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>236) - monkey.belozersky.msu.ru/ )

• ETS_all_contacts alignment
• Inquiry information || Formats of alignments
• SVETKA, a program for multiple sequence alignments analysus

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

Электронная библиотека Попечительского совета . ... Takatoh K., Hasegawa M., Itoh N. - Alignment Technologies and Applications of Liquid Crystal Devices . ... Название: Alignment Technologies and Applications of Liquid Crystal Devices . Авторы: Takatoh K., Hasegawa M., Itoh N. Аннотация: . ... Alignment Technologies and Applications of Liquid Crystal Devices demonstrates both the fundamental and practical aspects of alignment phenomena in liquid crystals. ...

Еще в разделе: (Показать все результаты (>591) - lib.mexmat.ru/ )

• Boudreau R.A. - Passive Micro-Optical Alignment Methods :: Электронная
• Hoque F. - The Alignment Effect: How to Get Real Business Value Out of
• Schmidt O.G. - Lateral Alignment of Epitaxial Quantum Dots :: Электронная

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>64) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>68) - num-meth.srcc.msu.ru/ )

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...