... file . ... annotate . ... blocks3d-wt: add an example of an alignment for input for the program . ... Thu, 15 Dec 2011 12:31:07 +0300 . ... dendik@848 . ... 8 * new : Alignments , Sequences and Blocks now can have Markups , see the wiki . ... 9 * new : File format 'markup' for storing alignment with arbitrary markups . ... 10 * new : processor allpy . ... 11 * new : method allpy . base . ... dendik@602 . ... 19 * new : started NEWS file . ... 20 * new : started tracking version numbers ...

Еще в разделе: (Показать все результаты (>113060) - kodomo.fbb.msu.ru/ )

• allpy: SETPATH annotate
• allpy: README.devel annotate
• allpy: test/test.py annotate

... About Trac . ... Previous Changeset . Next Changeset . ... Show lines around each change . Show the changes in full context Ignore: . Blank lines . Case changes . White space changes . ... example.snake: better rules for chasing enemy tail . ... snakes/example.snake (modified) ( 2 diffs ) . ... Note: See TracChangeset for help on using the changeset viewer. ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>5588) - kodomo.cmm.msu.ru/ )

• Changeset 134:8e75e931bfd2 for snakes тАУ Python Battle
• Changeset 121:06e4b4ea7596 тАУ Python Battle
• Changeset 121:06e4b4ea7596 for snakes тАУ Python Battle

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>243) - monkey.belozersky.msu.ru/ )

• About authors ot this complex
• About this project

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>133) - www.genebee.msu.ru/ )

• Genebee Predicted Annotation

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>26) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus

... Previous message: [Comphep-common] Re: $COMPHEP/genEvents . Next message: [Comphep-common] Re: a bug in comphep b76i (windows version) . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . Dear COMPHEP experts, Is it possible to evaluate width and branching ratios for a 1->2 process (for example ~1+ -> 2*x) in batch mode? ... More information about the Comphep-common mailing list . ...

Еще в разделе: (Показать все результаты (>808) - theory.sinp.msu.ru/ )

• Smoothing

Database: . ... Affymetrix official site . ... Clone/Gene ID converter . ... Probe set search: . Affymetrix probe set identifier example: "238900_at" . ... Search . Text search: . Gene official symbol (*-wildcard) example: "c1orf*" . Word or phrase in gene official name example: "receptor" . ... Gene search: . ENSEMBL gene identifier example: "ENSG00000026508" . NCBI Entrez Gene identifier example: 7503 . HUGO gene identifier example: 1681 . ...

Еще в разделе: (Показать все результаты (>6982) - mouse.belozersky.msu.ru/ )

• Geometrical core
• Example of alignment
• Alignment example

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Электронная библиотека Попечительского совета . ... Pap E. - Complex Analysis Through Examples And Exercises . ... Название: Complex Analysis Through Examples And Exercises . Автор: Pap E. Аннотация: . This volume on complex analysis offers an exposition of the theory of complex analysis via a comprehensive set of examples and exercises. ... Complex number 1 . ... Hadamard example 63 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8910) - lib.mexmat.ru/ )

• Althaus E. - A branch-and-cut algorithm for multiple sequence alignment ::
• Armitage G., Claypool M., Branch P. - Networking and Online Games:
• Liberty J. - Learning Visual Basic .NET :: Электронная библиотека

PHP Manual . ... PHP 4 >= 4.0.0) domxml_children -- Returns children of a node or document . array domxml_children ( object doc|node) . ... This function is EXPERIMENTAL . ... In the following example the variable children will contain an array with one node of type XML_ELEMENT. ... php $doc = new_xmldoc("1.0"); $root = $doc->add_root("HTML"); $head = $root->new_child("HEAD", ""); $head->new_child("TITLE", "Hier der Titel"); $head->set_attribute("Language", "ge"); $children = $head->children(); ?> ...

Еще в разделе: (Показать все результаты (>838) - oit.cmc.msu.ru/ )

• Java Distributed Computing course annotation
• getrusage

NGS Data Analysis with Unipro UGENE Olga Golosova, Yuriy Vaskin, German Grekhov, Yuliya Algaer UNIPRO, Lavrentieva ave. ... That is where Unipro UGENE NGS framework comes in play. ... Moreover, the UGENE toolkit allows one to automate common tasks by creating workflows with the integrated tools using the UGENE Workflow Designer. Analysis of NGS data with UGENE may start, for example, from quality control of raw NGS data, received from a sequencing facility, with the integrated FastQC [3] tool. ...

Еще в разделе: (Показать все результаты (>171) - mccmb.belozersky.msu.ru/ )

... Программа повышения квалификации ?Исследование природы вместе с детьми? ... День леса - 2013 . ... Содержание сборника, 2004 . ... из сборника Вместе со всей планетой , Пущино 1995 . ... Загадки и тайны мира природы очень интересны детям, даже самым маленьким. ... В 1995 г. мы вместе с учеными подмосковного города Пущино помогали школьникам выступить в роли экологических наставников для малышей . Заметка об этой работе была опубликована в журнале ЮНЕСКО Connect . ...

Еще в разделе: (Показать все результаты (>4) - kids.genebee.msu.ru/ )

... HierarchicalNavigation . Navigation block that displays the current topic, its parent and children (if any). ... Displaying the Parent - Current - Children block . ... STARTSECTION{ name = all }% div class = twikiHierarchicalNavigation ul %SEARCH{ parent type= query topic = %BASETOPIC% web= %BASEWEB% nonoise= on format= li class ='twikiParentTopic' img src='%ICONURL{ parent _gray}%' width='16' height='16' alt='' border='0' / [[$web.$ parent ][$ parent ]] /li }% li ...

Еще в разделе: (Показать все результаты (>39781) - dualopt1.cmm.msu.ru/ )

• HierarchicalNavigation - TWiki - TWiki - (printable)
• %TOPICTITLE% ( vs. 1) - TWiki
• %TOPICTITLE% (13 vs. 14) - TWiki

... The national strategic management system in Russian power industry is far from perfect and is in the process of its formation after a long period of radical reform in the industry. ... This article s goal is to offer a more adaptable conceptual model for national strategic management in a branch of economy (on the example of the electric power industry). ... National strategic management, power industry, conceptual model, level of environmental uncertainty. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>90) - ee-journal.spa.msu.ru/ )

... MLNKLSAEFFGTFWLVFGGCGSAILAA--AFP------ELGIGFLGVALAF . ... SSLAPAG-FAPIAIGFGLTLIHLVSIPVTNTWVNPARSTG--VA--LF-----ADTAAL . ... MGRKLLAEFFGTFWLVFGGCGSAVFAA--AFP------ELGIGFTGVALAF . ... HGRVPAG-FAPIAIGLALTLIHLISIPVTNTSVNPARSTG--QA--LF-----VGGWAL . ... MSQT---STLKGQCIAEFLGTGLLIFFGVGCVA--ALKVAG------ASFGQWEISVI-W . ... ANQFTEG-LNPLIVGFLIVAIGISLGGTTGYAINPARDLGPRIAHAFL---PIPGKGSS . ... YPHFKATED-----QG-----AKLAVFSTDP-AIKHLPANFFSEVLGTFVLVLGILAIG- . ... MIDTSLATQFLGEVIGTAILIILGAGVVAGVSLKRSK------AENGGWVVITLAW...

Еще в разделе: (Показать все результаты (>142) - bioinf.fbb.msu.ru/ )

• Input Formats
• SDPsite - Gallery of examples
• SDPpred

This diagram shows how the 'vertical-align' properties on cells combine to determine the height of the row containing the cells. The diagram also illustrates the meaning of some values of 'vertical-align' that apply to table cells: baseline, top, bottom, and middle. The diagram shows a row of five (labeled) table cells of varying heights and alignments. ... The first cell is aligned with the row baseline and extends to just below the row top. ...

Еще в разделе: (Показать все результаты (>2373) - crydee.sai.msu.ru/ )

• A Simple Example With a Single Chirp Component
• One example
• Dynamic HTML in Communicator

You are here: Foswiki > System Web > HierarchicalNavigation (23 Aug 2010, ProjectContributor ) E dit A ttach . Navigation block that displays the current topic, its parent and children (if any). ... children . ... STARTSECTION{ all }% div class = foswikiHierarchicalNavigation ul %SEARCH{ parent type= query topic = %BASETOPIC% web = %BASEWEB% nonoise= on format= li class ='foswikiParentTopic' $percentICON{ parent _gray}$percent [[$ web .$ parent ][$ parent ]] /li }% li ...

Еще в разделе: (Показать все результаты (>6529) - wiki.cmc.msu.ru/ )

• WebNotify < _default < Foswiki
• WebNotify < Practicum < Foswiki
• WebNotify < Main < Foswiki

Wood Plant body Morphology of shoot Introduction to Botany. ... Shipunov BIOL 154.8 Wood Plant body Morphology of shoot Monday test (5 points) 5 Components of bark ( 1) Shipunov BIOL 154.8 Wood Plant body Morphology of shoot Outline 1 Wood Plant body Morphology of shoot Components of shoot Branching Arrangement of leaves 2 3 Shipunov BIOL 154.8 Wood Plant ... Plant Biology. 2nd edition. ... Shipunov BIOL 154.8 ...

Еще в разделе: (Показать все результаты (>140) - herba.msu.ru/ )

The Isaac Newton Institute (Instituto Isaac Newton) for astronomical research (INI) was founded in 1978 by Gonzalo Alcaino. The main office is located in the eastern outskirts of Santiago (Chile). ... The Moscow branch was the first one established outside Chile. ... Besides the above named branches, the Chilean staff of the Isaac Newton Institute is involved in collaboration with astronomers of the Observatory of Rome in several research projects using data secured from telescopes in Chile. ...

Еще в разделе: (Показать все результаты (>364) - xray.sai.msu.ru/ )

• Ivan's contribution to GMT 3.2

... Apache HTTP Server Version 2.0 . ... A single control process launches the number of child processes indicated by the NumServers directive at server startup. ... For each child process, Apache assesses the number of idle threads and creates or destroys threads to keep this number within the boundaries specified by MinSpareThreads and MaxSpareThreads . ... The User and Group directives are used to set the privileges of the Apache child processes. ... Maximum number of threads per child process . ...

Еще в разделе: (Показать все результаты (>815) - uneex.lorien.cs.msu.su/ )

• HelpOnImages - UNИX
• HelpOnTables - UNИX
• mod_example - Apache HTTP Server