... Changed the way related types are stored for Alignment, Block, Sequence, Monomer Now each of them has attribute 'type', which is an object with four attributes: - Alignment - Block - Sequence - Monomer . ... allpy/base.py allpy/dna.py allpy/protein.py allpy/rna.py . ... allpy/base.py . ... allpy/dna.py . ... allpy/protein.py . ... allpy/rna.py . ... 1.59 - # Actually given value at EOF, since name Block is not yet defined 1.60 - 1.61 - sequence_type = Sequence 1.62 - """Type of sequences in...

Еще в разделе: (Показать все результаты (>113143) - kodomo.fbb.msu.ru/ )

• allpy: 5639138f619a
• allpy: df571a5233fb test/usecase1.py
• allpy: allpy/base.py diff

... Previous Changeset . Next Changeset . ... Show lines around each change . ... Added Cell attribute snake_type to snake.Rule pattern cells . ... assert line == '', "Rules must be separated by empty lines" €а . ... assert char.lower() in self.codes, "Illegal symbol in rule: %s" % char €а . ... cell.snake = 'my' €а . ... cell.snake _type = 'my' €а . ... cell.snake = 'enemy' €а . ... cell.snake _type = 'enemy' €а . ... assert (x, y) == (3, 3), "Own head must in the center of rule" €а . ...

Еще в разделе: (Показать все результаты (>5076) - kodomo.cmm.msu.ru/ )

• Changeset 44:a7e53eb3f54d ? Python Battle
• Changeset 116:10d32d7755ff тАУ Python Battle
• Changeset 8:4f578d001608 тАУ Tanchiki

... Vertical alignment of header cells; overrides valign . unspecified . ... Vertical alignment of cells and headers, set to "top" , "middle" , "bottom" or "baseline" . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). unspecified . ... Header cell text colour. "#ffffff" . ...

Еще в разделе: (Показать все результаты (>27789) - dualopt1.cmm.msu.ru/ )

• VarTABLE - TWiki - TWiki - (printable)
• VarTABLE - TWiki - TWiki

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>110) - uneex.lorien.cs.msu.su/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>40) - uneex.mithril.cs.msu.su/ )

... Is only visible when cellspacing is larger than 1, or cellborder is 0 , or tablerules is none , otherwise the cell borders overlap the table border. unspecified . ... Table rules, set to "none" (no rules), "groups" (rules will appear between row groups and column groups only), "rows" (rules will appear between rows only), "cols" (rules will appear between columns only), "all" (rules will appear between all rows and columns). ... unspecified . ... This topic: System > Plugins > TablePlugin > VarTABLE...

Еще в разделе: (Показать все результаты (>3545) - wiki.cmc.msu.ru/ )

... Content Model: Table Cells (TH or TD) . The TR element acts as a container for a row of table cells defined with the TH or TD elements. ... You also have the ability to disable word wrap for the row, and thereafter use the <BR> element to determine line breaks and hence cell widths. ... The recommended approach is to subclass rows using the CLASS attribute For example: <TABLE BORDER COLSPEC= .. ... ALIGN . ... This is used when you want to ensure that all cells in the row share the same baseline. ...

Еще в разделе: (Показать все результаты (>64) - comet.sai.msu.ru/ )

• Paragraphs
• Horizontal Tabs
• HTML Math

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6976) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Электронная библиотека Попечительского совета . ... Eckstein R., Spainhour S. - Webmaster in a Nutshell . ... Название: Webmaster in a Nutshell . Авторы: Eckstein R., Spainhour S. Аннотация: . Webmaster in a Nutshell is a concise and portable quick reference guide that distills an immense amount of information on several languages and technologies into one compact book. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>1584) - lib.mexmat.ru/ )

• Dubinko M. - XForms Essentials :: Электронная библиотека попечительского совета
• Robbins J.N. - Web Design in a Nutshell :: Электронная библиотека
• Takatoh K., Hasegawa M., Itoh N. - Alignment Technologies and Applications of

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>99) - www.genebee.msu.ru/ )

• Screening of pattern or alignment against PROTEIN databank
• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction

previous next contents elements attributes index . ... Alignment . ... Font style elements: the TT , I , B , BIG , SMALL , STRIKE , S , and U elements . ... This attribute specifies the horizontal alignment of its element with respect to the surrounding context. ... You could reduce the scope of the style by setting the class attribute on the element: <HEAD> <TITLE>How to Carve Wood</TITLE> <STYLE type="text/css"> H1.wood {text-align: center} </STYLE> <BODY> <H1 class="wood"> How to Carve Wood </H1> . ...

Еще в разделе: (Показать все результаты (>1310) - crydee.sai.msu.ru/ )

• Index of the HTML 4.0 Attributes
• Conformance: requirements and recommendations
• HTML 4.0 Specification

... Font style elements: the TT , I , B , BIG , SMALL , STRIKE , S , and U elements . ... This attribute specifies the horizontal alignment of its element with respect to the surrounding context. ... ELEMENT FONT - - ( %inline; )* -- local change to font --> <!ATTLIST FONT %coreattrs; -- id , class , style , title -- size CDATA #IMPLIED -- [+]nn e.g. size="+1", size=4 -- color CDATA #IMPLIED -- #RRGGBB in hex, e.g. red: "#FF0000" -- face CDATA #IMPLIED -- comma separated list of font names -- > . ...

Еще в разделе: (Показать все результаты (>104) - itpm.msu.su/ )

• Changes between HTML 3.2 and HTML 4.0
• Definitions and Conventions
• Index of the HTML 4.0 Attributes

SVETKA, a program for analysis of different alignments . Back to the help page . ... Such a feature can look like " Leucine in the position 362 of the alignment of the entire family " and can, in many cases, be a "decision rule" to distinguish sequences from two sides of a tree branch. ... Comparing the alignment with an input tree (the tree may be entered by the user or reconstructed with the WPGMA algorithm), the program detects supporting positions of the alignment for every branch the tree. ...

Еще в разделе: (Показать все результаты (>251) - monkey.belozersky.msu.ru/ )

• SDP home page
• ETS_all_contacts alignment
• Inquiry information || Formats of alignments

... Attributes . ... This requires that attributes be tagged either as ``C,'' ``C++'' or ``Fortran,'' and that the language tag be checked in order to use the right calling convention for the callback function. ... The attribute manipulation functions described in Section 5.7 of the MPI-1 standard define attributes arguments to be of type void* in C, and of type INTEGER, in Fortran. ... Fortran attribute functions put and get integer valued attributes. ... A. C to Fortran . ... Fortran code . ... Центры...

Еще в разделе: (Показать все результаты (>198) - www.parallel.ru/ )

• Window Attributes | PARALLEL.RU - Информационно-аналитический центр по
• Clarification of Error Behavior of Attribute Callback Functions | PARALLEL.RU -
• New Attribute Caching Functions | PARALLEL.RU - Информационно-аналитический

... public class Attribute . ... They have a name, type and an array of values. ... Attribute (java.lang.String name, double value) . ... If the value represents an array type, returns the Class object representing the component type of the array; otherwise returns null. int . ... Constructor Detail public Attribute (java.lang.String name, java.lang.Number value) . ... public Attribute (java.lang.String name, double value) . ... public Attribute (java.lang.String name, java.lang.Object theValue) . ...

Еще в разделе: (Показать все результаты (>51) - angel.cs.msu.su/ )

• : Interface AttributeSet
• : Class ProtoVariable
• : Class Schema

Network Working Group Request for Comments: 1464 R. Rosenbaum Digital Equipment Corporation May 1993 Using the Domain Name System To Store Arbitrary String Attributes Status of this Memo This memo defines an Experimental Protocol for the Internet community. ... Abstract While the Domain Name System (DNS) [2,3] is generally used to store predefined types of information (e.g., addresses of hosts), it is possible to use it to store information that has not been previously classified. ...

Еще в разделе: (Показать все результаты (>8841) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1464.txt
• Index of /pub/gentoo-portage/virtual/perl-Attribute-Handlers/

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... PHP 3 <= 3.0.18, PHP 4 >= 4.0.0) ldap_get_attributes -- Get attributes from a search result entry . ... return_value[0] = first attribute . ... ds is the link identifier for the directory // $sr is a valid search result from a prior call to // one of the ldap directory search calls $entry = ldap_first_entry($ds, $sr); $attrs = ldap_get_attributes($ds, $entry); echo $attrs["count"]." attributes held for this entry:<p>"; for ($i=0; $i<$attrs["count"]; $i++) echo $attrs[$i]."<br>"; . ...

Еще в разделе: (Показать все результаты (>165) - oit.cmc.msu.ru/ )

• ldap_first_attribute
• hw_Modifyobject
• ldap_next_attribute

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster