... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6976) - mouse.belozersky.msu.ru/ )

... 14 def is_good_window ( window ): . ... 20 blocks = [] . 21 in_block = False . ... 24 in_block , was_in_block = is_good_window ( window ), in_block . 25 if in_block and not was_in_block : . ... Block . from_alignment ( alignment , columns = list ( window )) . ... 28 elif in_block : . ... 32 def blocks_markup ( alignment , blocks ): . ... 36 for column in block . ... in_block for column in alignment . ... 45 blocks = find_runs ( alignment ) . ... 52 blocks_markup ( alignment , blocks ), . ...

Еще в разделе: (Показать все результаты (>38083) - kodomo.fbb.msu.ru/ )

• allpy: 73070c394dc4 test/usecase1.py
• allpy: a179d48a9caf
• allpy: 73070c394dc4 allpy/fileio.py

fdnaml Estimates nucleotide phylogeny by maximum likelihood Standard (Mandatory) qualifiers : [-sequence] seqsetall File containing one or more sequence alignments [-intreefile] tree Phylip tree file (optional) [-outfile] outfile [*.fdnaml] Phylip dnaml program output file Additional (Optional) qualifiers (* if not always prompted): -ncategories integer [1] Number of substitution rate categories ( Integer from 1 to 9) * - ...

Еще в разделе: (Показать все результаты (>1728) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/bl2seq.html
• http://kodomo.cmm.msu.su/FBB/year_09/perl/DBSchema.pdf

... An integer is a number of the set Z = {.. ... See also: Arbitrary precision integers and Floating point numbers . ... a = 1234; # decimal number $a = -123; # a negative number $a = 0123; # octal number (equivalent to 83 decimal) $a = 0x1A; # hexadecimal number (equivalent to 26 decimal) The size of an integer is platform-dependent, although a maximum value of about two billion is the usual value (that's 32 bits signed). ... There is no integer division operator in PHP. 1/2 yields the float 0.5 . ...

Еще в разделе: (Показать все результаты (>231) - oit.cmc.msu.ru/ )

• Longs (Integers)
• is_integer
• printer_set_option

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Детализация рейтинга: integer . ... Common . ... Forum . ... Network . ... Common.Недвижимость . ... Common.Trading . ... Re: Курение в подъезде жилого дома. integer . ...

Еще в разделе: (Показать все результаты (>2394) - www.fds-net.ru/ )

• Персональная информация о integer - Public forum of MSU united student networks
• User stats: integer - Public forum of MSU united student networks
• Нужен математик на 4 июня *DELETED* - Public forum of MSU united student

Электронная библиотека Попечительского совета . ... Gelfond A.O. - The Solution of Equations in Integers . ... Название: The Solution of Equations in Integers . Автор: Gelfond A.O. Язык: . ... Equation, 51 . ... Equation, 127x-52y+1=0 5 . ... Exponential equation 61 . ... Gelfond, A.O. iii 46 62 . ... Minimal solution 26 . ... Pell's equation 26 . ... Relatively prime integers 2 . ... Solution (of ax+by+c=0) 4 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>2189) - lib.mexmat.ru/ )

• Поиск книг, содержащих Тип данных, оператор INTEGER :: Электронная библиотека
• Поиск книг, содержащих Integer part :: Электронная библиотека попечительского
• Поиск книг, содержащих Gaussian integers :: Электронная библиотека

... Derived datatypes . Up: Point-to-Point Communication Next: Datatype constructors Previous: Null processes . ... Instead, MPI provides mechanisms to specify more general, mixed, and noncontiguous communication buffers. ... More general communication buffers are specified by replacing the basic datatypes that have been used so far with derived datatypes that are constructed from basic datatypes using the constructors described in this section. ... A sequence of basic datatypes . ... Центры . ...

Еще в разделе: (Показать все результаты (>482) - www.parallel.ru/ )

• External Interfaces | PARALLEL.RU - Информационно-аналитический центр по
• Lower-bound and upper-bound markers | PARALLEL.RU - Информационно-аналитический
• MPI-2 Fortran Subroutines | PARALLEL.RU - Информационно-аналитический центр по

... Войти в систему . ... Blasiak P., Dattoli G. , Horzela A. , Penson K.A., Zhukovsky K. в журнале Journal of Integer Sequences , издательство University of Waterloo (Canada) , том 11, с. 1-11 . ... Kolpakov R. в журнале Journal of Integer Sequences , издательство University of Waterloo (Canada) , том 10, ? ... в журнале Journal of Integer Sequences , издательство University of Waterloo (Canada) , том 5, ? ...

Еще в разделе: (Показать все результаты (>198) - istina.msu.ru/ )

... Peptide Sequence Databases . ... BLAST searches can be limited to the results of an Entrez query against the database chosen. ... For example: Mus musculus[Organism] For help in constructing Entrez queries please see the " Writing Advanced Search Statements " section of the Entrez Help document. ... Only following combinations of the Matrix, Open & Extended Gaps are available: Recomended combinations are colored. ... Gap . ... Standard BLAST alignment in pairs of query sequence and database match. ...

Еще в разделе: (Показать все результаты (>94) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services Help
• AliGraf - GeneBee Graphical Alignment Help
• GeneBee

... All contacts alignment . ... Blue background means a contact with backbone phosphate. ... HBond with major groove + contact through a molecule of water with backbone phosphate; . ... contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + engagement in hydrophobic cluster + contact through a molecule of water with backbone phosphate; ...

Еще в разделе: (Показать все результаты (>237) - monkey.belozersky.msu.ru/ )

• Inquiry information || Formats of alignments
• SVETKA, a program for multiple sequence alignments analysus
• SVETKA, a program for multiple sequence alignments analysis

... Ryabov G.G., Serov V.A. The development of discrete models for representations of nonconvex parts of $R^3$ space and the solution of routing problems with a metric that approximates the Euclidean metric on these models continue to remain fundamental in the fields of robotics, geoinformatics, computer vision, and designing of VLSI. The paper deals with a lattice-cellular model. ... PostScript (in Russian) (8.56MB) . PDF (in Russian) (1.21MB) . PostScript. zip (in Russian) (1.33MB) . ...

Еще в разделе: (Показать все результаты (>33) - num-meth.srcc.msu.ru/ )

• "ALIGNMENT IN FREE DECAYING MHD TURBULENCE"

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

You are here: Foswiki > System Web > ReferenceManual > DeveloperDocumentationCategory > PerlDoc (19 Apr 2011, ProjectContributor ) E dit A ttach . ... package Foswiki::Configure::Item . ObjectMethod getDepth() $integer . ... ObjectMethod getSectionObject($head, $depth) $item . ObjectMethod getValueObject($keys) $value . ... A configuration component may be a collection item (a ConfigSection ), an individual Value, or a checker associated with a value (or a node in a checker tree). ... System . ...

Еще в разделе: (Показать все результаты (>3266) - wiki.cmc.msu.ru/ )

... MAXLEN parameter specifies maximum length of the number considered as a 'good' integer. ... If REJECTLONG = FALSE (default), than dictionary returns prefixed part of integer number with length MAXLEN . ... This is a dict_tmpl.c file. # include postgres.h # include utils/builtins.h # include fmgr.h #ifdef PG_MODULE_MAGIC PG_MODULE_MAGIC; #endif # include utils/ts_locale.h # include utils/ts_public.h # include utils/ts_utils.h typedef struct { int maxlen ; bool rejectlong ; } ...

Еще в разделе: (Показать все результаты (>392) - www.sai.msu.su/ )

• Zen: GinTestUpdate
• Zen: GinTest
• SAL- Other Scientific Fields - Chemistry, Biology Related - Evalign

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>90) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf

... Символическое умножение прямоугольных разреженных матриц, заданных в формате RR (C) U . ... Unit TAMMIR_p; interface uses SysUtils, Math, { Delphi } LStruct, Lfunc, UtRes_p, AMMIR_p ; function TAMMIR: String; implementation function TAMMIR: String; var NP,NQ,NR,_i : Integer ; IC : Array [0..4] of Integer ; JC : Array [0..3] of Integer ; IX : Array [0..2] of Integer ; const IA : Array [0..4] of Integer = ( 1,4,4,6,7 ); JA : Array [0..5] of Integer = ( 1,5,4,4,2,1 ); IB : Array [0..5] of...

Еще в разделе: (Показать все результаты (>1451) - num-anal.srcc.msu.ru/ )

• БЧА НИВЦ МГУ. MLC6R_P. Задача целочисленного линейного программирования
• БЧА НИВЦ МГУ. MLC3R_P. Задача целочисленного линейного программирования
• БЧА НИВЦ МГУ. MLOGR_P. Общая задача линейного программирования

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... integer . ... Продается полка напольная . ... Re: Продается полка напольная [ re: integer ] . ... Re: Продается полка напольная [ re: BLR ] . ... забрали полку? ...

Еще в разделе: (Показать все результаты (>1505) - www.snto-msu.net/ )

• Вопрос по указателям для типа record (Delphi) - Public forum of MSU united
• Re: Первосентябрьское - Public forum of MSU united student networks
• [win2008] Enterprise vs Datacenter - Public forum of MSU united student...

... CROSSBOW Definition 4.1 CROSSBOW Group OBJECT : fmxHubHwVer { fmxSystemGrp 1 } Syntax : OCTET STRING Definition : Access : read-only Status : mandatory OBJECT : fmxHubFwVer { fmxSystemGrp 2 } Syntax : OCTET STRING Definition : Access : read-only Status : mandatory OBJECT : fmxHubAddress { fmxSystemGrp 3 } Syntax : OCTET STRING Definition : Access : read-only ...

Еще в разделе: (Показать все результаты (>9403) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc345.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc345.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc401.txt.pdf