... Fri, 17 Dec 2010 00:25:46 +0300 . Daniil Alexeyevsky . Trivial fixes in allpy.base.Block . ... Thu, 16 Dec 2010 23:45:57 +0300 . ... Moved leftover junk from allpy.base to allpy.pdb . ... Changed interfaces of allpy.fasta, updated allpy.base accordingly . ... Wed, 15 Dec 2010 23:45:11 +0300 . ... Tue, 14 Dec 2010 21:06:42 +0300 . ... Moved contents of block.py to base.py without any changes. ... Sat, 04 Dec 2010 00:19:17 +0300 . ... allpy: monomers completed . ... allpy: add base.py 1.1.0 . ...

Еще в разделе: (Показать все результаты (>113151) - kodomo.fbb.msu.ru/ )

• allpy: c2ff3beb5821
• allpy: log
• allpy: 5639138f619a

... Previous Changeset . ... View differences inline side by side . ... Actually fixed buttons resizing. Fixed code separation for buttons drawing. ... self.canvas.pack(side ="top", fill="both", expand="yes") €а . ... buttons.pack(side ="bottom", fill="both", expand="yes") €а . ... self.buttons_pack(self.root).pack(side ="bottom", fill="both", expand="no") €а . ... load_1 = tk.Button(frame, text="Load 1", command=lambda: self.load(1)) €а . ... load_1.pack(side="left", fill="both", expand = "no") €а . ...

Еще в разделе: (Показать все результаты (>5021) - kodomo.cmm.msu.ru/ )

• Changeset 96:3619305694ad for snakes тАУ Python Battle
• Changeset 109:7352863453bc тАУ Python Battle
• Changeset 142:8b5bc7bda225 тАУ Python Battle

Alignment DNA issues are still actual in modern genetics. Known algorithms (for example, heuristic algorithm used by BLAST software, Needleman­Wunsch algorithm) are provide solution, but possible are not completely optimal by speed, computational resources or don't provide fullness search (needed accuracy) for solution finding. ... In this paper a method that can ensure absolute accuracy, is presented. ... Known methods of alignments are discussed and demonstrated. ...

Еще в разделе: (Показать все результаты (>75) - mccmb.belozersky.msu.ru/ )

... 2010 November 9 . NGC 4452: An Extremely Thin Galaxy . ... NGC 4452, a galaxy in the nearby Virgo Cluster of Galaxies , is so thin that it is actually difficult to determine what type of disk galaxy it is. ... Near NGC 4452 's center is a slight bulge of stars, while hundreds of background galaxies are visible far in the distance. ... Galaxies that actually are this thin are relatively common -- for example our own Milky Way Galaxy is thought to be about this thin . ... About APOD | ...

Еще в разделе: (Показать все результаты (>1134) - www.sai.msu.su/ )

• APOD: 2008 May 10 - Stars and Mars
• APOD: February 2, 1998 - A Triple Eclipse on Jupiter
• APOD: 2006 June 13 - Driving Toward a Sun Halo

NGC 4452: An Extremely Thin Galaxy . ... In one of the more precise alignments known in the universe, what is pictured above is actually a disk galaxy being seen almost perfectly edge on. ... NGC 4452, a galaxy in the nearby Virgo Cluster of Galaxies , is so thin that it is actually difficult to determine what type of disk galaxy it is. ... Galaxies that actually are this thin are relatively common -- for example our own Milky Way Galaxy is thought to be about this thin . ...

Еще в разделе: (Показать все результаты (>5847) - www.astronet.ru/ )

• NGC 4452: An Extremely Thin Galaxy
• Stars and Mars
• A Triple Eclipse on Jupiter

. Album : asv-album :: Travels to distant places and countries :: 1997/08 Kyoto, Nara (Japan) :: 23/08 Ryoanji Temple and around . Up . << Prev . A bug which produces loud high-pitched noise. The actual length is about 5-6 cm. Next >> . Created with the tool album generator a MarginalHack by David on Tue Jun 23 14:46:19 2015 .

Еще в разделе: (Показать все результаты (>853) - crydee.sai.msu.ru/ )

• Image: You probably get bored to see hotel again :-) But actually, there wasn't
• Image: I believe this is the actual Otani shrine. Otani was a monk who founded
• Image: Good bye, Chalkidiki! . Oh, sorry, it is actually a greeting to who

Электронная библиотека Попечительского совета . ... Otteson J.R. - Actual Ethics . ... Название: Actual Ethics . Автор: Otteson J.R. Аннотация: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>1687) - lib.mexmat.ru/ )

• Actual Test: Implementing, Managing and Maintaining a MS Windows Server 2003
• Hoque F. - The Alignment Effect: How to Get Real Business Value Out of
• Al-Hakim L., Memmola M. - Business web strategy: design, alignment and

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>23) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus

Актуальные проблемы современной териологии . С 18-22 ноября 2012 года состоялась всероссийская научная конференция "Актуальные проблемы современной териологии". ... Актуальные проблемы современной териологии: Тезисы докладов (18-22 сентября 2012 г. Новосибирск). ... Жигалин А.В., Хританков А.М. О сроках и особенностях размножения некоторых видов рукокрылых юга Сибири. ... Жигалин А.В. Состав фауны эктопаразитов рукокрылых некоторых районов Сибири. ... Крускоп С. В. О проблеме вида у рукокрылых. ...

Еще в разделе: (Показать все результаты (>425) - zmmu.msu.ru/ )

• Contribution to the species composition and taxonomic status of some Rattus

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Love Actually - Christmas is All Around . ... Re: Love Actually - Christmas is All Around [ re: a47 ] . ... Re: Love Actually - Christmas is All Around [ re: Stepa ] . ...

Еще в разделе: (Показать все результаты (>372) - www.fds-net.ru/ )

• Как взломать Actual Spy Monitor? - Public forum of MSU united student networks
• Actual - Public forum of MSU united student networks
• Love actually - Public forum of MSU united student networks

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Love Actually - Christmas is All Around . ... Re: Love Actually - Christmas is All Around [ re: a47 ] . ... Re: Love Actually - Christmas is All Around [ re: Stepa ] . ...

Еще в разделе: (Показать все результаты (>202) - www.snto-msu.net/ )

• Как взломать Actual Spy Monitor? - Public forum of MSU united student networks

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: it?s actually regularly involving youthfu . ... Prior to picking a sunglass you may need some very good facts. ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>3829) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: it is actually on a regular
• Экологический Форум - Фундаментальная Экология: billion actually fox of of of
• Экологический Форум - Фундаментальная Экология: Eight actually is the of the B

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6976) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>109) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced
• TreeTop - Phylogenetic Tree prediction

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>236) - monkey.belozersky.msu.ru/ )

• HTH3_numeration_assumed
• ETS_all_contacts alignment
• Inquiry information || Formats of alignments

The plugin central factory. ... List of all member functions. virtual  ~QNPlugin  ()  . ... One instance of this object is created when the plugin is first needed, by calling QNPlugin::create (), which must be implemented in your plugin code to return some derived class of QNPlugin. ... This may only be used by the constructor derived class returned by plugin's implementation of the QNPlugin::create () function. ... Override to return a reference to the Java class that represents the plugin. ...

Еще в разделе: (Показать все результаты (>300) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QGroupBox Class
• Qt Toolkit - QHeader Class
• Qt Toolkit - QLNode Class

... RECEIVED(settlement,maturity,investment,rate[,basis]) . RECEIVED calculates and returns the amount to be received at @maturity date for a security bond. @settlement is the settlement date of the security. @maturity is the maturity date of the security. ... 1 actual days/actual days . 2 actual days/360 . ... If @settlement date or @maturity date is not valid, RECEIVED returns #NUM! error. ... If @settlement date is after @maturity date or they are the same, RECEIVED returns #NUM! error. ...

Еще в разделе: (Показать все результаты (>171) - uneex.lorien.cs.msu.su/ )

• YIELDDISC
• PRICE
• YIELD

RUSSIAN PEREPLET . Culture, Science, and Education Portal . Science Space Culture General Discussion Scientific Discussion Seminars . News: The best of Russian Science and Technology . ... MASTER Team Science Release: Discovery of the Black Hole Ergosphere? ... The International Conference "The International Conference" . ... MASTER is the first russian asteroid factory . ... New Russian "Volga" . ... MASTER - is the first russian robotic telescope for observations Gamma-Ray Bursts . ...

Еще в разделе: (Показать все результаты (>152) - www.pereplet.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

# # ChangeLog for / # # Generated by Trac 0.12.5 # 04/11/16 23:15:36 Sun, 19 Dec 2010 23:26:49 GMT Alex Martynov [98:4436cf8ba30c] * main.py (modified) * main.py (modified) merge Sun, 19 Dec 2010 23:26:31 GMT Alex Martynov [97:c89777ba44ec] * main.py (modified) main.UI.dead_snakes_check() Sun, 19 Dec 2010 23:26:35 GMT Danya Alexeyevsky <me.dendik@тАж> [96:3619305694ad] * main.py (modified) Actually fixed buttons resizing. Fixed code separation for buttons ...

Еще в разделе: (Показать все результаты (>821) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=98%3A4436cf8ba30c&stop_rev=96%3A3619305694ad&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=4436cf8ba30c3522ccc594ae40eb8ef475ddd065&stop_rev=3619305694ad0e54c71cfdd53f477ce8f80ba962&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=6cdd9eb62aa06498e53a099723278b3936d14b7f&limit=100&mode=stop_on_copy