Электронная библиотека Попечительского совета . ... Petrov V.V. - Sums of Independent Random Variables . ... Название: Sums of Independent Random Variables . Автор: Petrov V.V. Язык: . ... Convergence (of sequences of random variables), almost certainly 264 . ... Distribution function of a random variable 2 . ... Independent random variables 6 7 . ... Random variables 2 . Random variables, independent 6 7 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>18144) - lib.mexmat.ru/ )

• Gnedenko B.V., Kolmogorov A.N., Chung K.L. - Limit Distributions for Sums of
• Gnedenko B.V., Kolmogorov A.N. - Limit Distributions for Sums of Independent
• Sachkov V.N. - Probabilistic Methods In Combinatorial Analysis :: Электронная

Next: Building sendmail.cf Up: Installing sendmail Previous: Installing sendmail . First, you have to unpack the archive file in some safe location: . If you have a ``modern'' tar, for example from a recent Slackware Distribution, you can probably just do a tar -zxvf filename.tgz and get the same results. Unpacking the archive creates a directory named sendmail5.65b+IDA1.5+mailx5.3b. In this directory, you find a complete installation of sendmail+IDA plus a binary of the mailx user agent. ...

Еще в разделе: (Показать все результаты (>393) - itpm.msu.su/ )

• The Linux Kernel (Copyright Notice)
• Terms and Conditions for Copying, Distribution, and Modification
• The /usr filesystem

Type of Galaxies. taken from the Hubble Atlas of Galaxies. These galaxies display no bright blue stars like those in the spiral arms of Sb, Sc, Irr, SBb, and SBc galaxies. ... The smooth texture of the photographic image. ... SBa - Galaxies possesss a characteristic bar that is prominent and smooth in texture with no trace of resolution into knots or stars. ... SBb - These galaxies have a well defined bar structure which is smooth in texture with no hint of resolution into stars. ...

Еще в разделе: (Показать все результаты (>3439) - www.sai.msu.su/ )

• The Network Time Protocol (NTP) Distribution
• SAL- Programming - X11 Libraries Toolkits - JX
• SAL- Parallel Computing - Tools Utilities - Clustor

. Next: Space position Up: Initial conditions Previous: Initial conditions . Space position . Initial velocity . Mike E. Prokhorov . Fri Jul 19 19:16:07 MSD 1996

Еще в разделе: (Показать все результаты (>479) - xray.sai.msu.ru/ )

• State of the problem
• Initial conditions
• Old neutron star distribution in the Galaxy

... Species distribution . ... Sequence conservation . ... According to Pfam database there have been found 7134 HTH3 gene sequences in 975 various species. Most of the these sequences were found in different bacteria, though they were also found in viruses and phages, archaea and eukaryotes. Among bacteria (totally 666 species) HTH3 genes are widely distributed and present in Bacterioidetes (12 species), Cyanobacteria (20), Actinobacteria (73), Proteobacteria (353), Firmicutes (164) and others. ...

Еще в разделе: (Показать все результаты (>1444) - monkey.belozersky.msu.ru/ )

• ETS species distribution
• ETS numeration assumed
• ETS sequence conservation

Modeling of single top tW+b signal at the LHC Slava Bunichev Moscow State University In collaboration with E. Boos and L. Dudko http://comphep.sinp.msu.ru Single top quark production at the LHC: leading order diagrams for single top production t-channel s-channel associated tW production Single Top tWb processes at the LHC: tWb channel gives a significant contribution to the Single Top signal at the LHC Discriminate single top tWb and tt-bar events 2. ...

Еще в разделе: (Показать все результаты (>179) - qfthep.sinp.msu.ru/ )

... Interface description . ... 6 Distributed array creating and deleting . ... 13.4 Access to elements of local part of distributed array . 13.4.1 Requesting if array element is allocated in local part of distributed array . ... 13.4.5 Coping element of local part of distributed array to element of local part of other distributed array . 13.4.6 Requesting address of element of local part of distributed array . ... 14.5 Access to distributed array elements, allocated in remote element buffer . ...

Еще в разделе: (Показать все результаты (>167) - sp.cs.msu.ru/ )

• Fortran DVM language description. Part 3 (7-12)
• Lib-DVM. Preliminary design
• DVM-system. Version history

A Pleistocene Climatic Record on the Basis of a Complete Loess-Paleosol Sequence in Central China . ... A complete climatic signal in the loess plateau of Central China was obtained by combining the loess-paleosol record from soil unit S0 until S15 of the Huangling section with that from unit S9 until loess unit L36 of the Jiacun section near Baoji. ... This suggests that the climatic signal retrieved from the soil-paleosol sequence in Central China reflects global long term climatic changes. ...

Еще в разделе: (Показать все результаты (>183) - www.fadr.msu.ru/ )

... Goals and Tasks . ... General classification of social structures in ants was developed, and the main types of temporal and constant social structures, as well as the ways of their formation and restructuring were determined. ... On the basis of comparative morphological and functional analysis of the wings of Coleopterans , the original theory of beetle wings evolution was grounded. ... One of the main research objects . ...

Еще в разделе: (Показать все результаты (>4900) - www.sevin.ru/ )

• Laboratories: Laboratory for Microevolution and Domestication of Mammals:
• Laboratories: Laboratory for Ecology of Lower Vertebrates: Goals and Tasks
• Laboratories: Laboratory for Synecology: Publications

Copyright 1999-2016 Gentoo Foundation # Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI=6 BASHCOMP_P =bashcomp-2.0.2 inherit versionator DESCRIPTION= Programmable Completion for bash HOMEPAGE= https://github.com/scop/ bash-completion SRC_URI= https://github.com/scop/ bash-completion /releases/download/${PV}/${P}.tar.xz https://bitbucket.org/mgorny/bashcomp2/downloads/${ ...

Еще в разделе: (Показать все результаты (>47965) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/app-shells/bash-completion/bash-completion-2.1_p20141224-r2.ebuild
• http://mirror.msu.net/pub/gentoo-portage/app-shells/bash-completion/bash-completion-2.1_p20141224-r1.ebuild
• FYI: 1

AC192956_1 [1 - 336] Candidatus Regiella insecticola clone CUGI_APP_BA-03-N07, complete sequence. ... MPLLRQFAGVCVDAIPSDPTLLHFRHWLEKHHLSETLFEEVNTHLASLQLFIKRGSIVDA TIIHAPSSTKNRQNTRDPDMKATRKGNQCYCGMKAHIGVDAQTGLVHSLVGASANVADVT QVHHLLHGQEEVVHGDAGYKGVMRLSEHQHRVVTWRIPRWRVLALPGQGQQV >AC192956_7 [6996 - 6688] (REVERSE SENSE) Candidatus Regiella insecticola clone CUGI_APP_BA-03-N07, complete sequence. ...

Еще в разделе: (Показать все результаты (>4794) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~christablel/term3/blastn.1fasta
• http://kodomo.cmm.msu.ru/~vanilin/3_1/tRNA_blastn.txt
• http://kodomo.cmm.msu.ru/~is_rusinov/projects/NucleicSeq/acG.orf

... Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: 1. Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. ... Redistribution and use of this software, with or without modification, is permitted provided that the following conditions are met: 1. ... All related source code must be included. ... Various other copyrights apply. ...

Еще в разделе: (Показать все результаты (>4271) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/ftproot/pub/comp/os/os2/hobbes/incoming/jalv24q3.txt.txt
• http://crydee.sai.msu.ru/ftproot/pub/rec/games/idgames/levels/doom2/m-o/missun.txt
• Energy distribution

... Documentation . Up: Contents Next: Configuring
 mpich
 Previous: Obtaining and Unpacking the Distribution . This distribution of mpich comes with complete man pages for the MPI routines, the MPE extensions, and the ADI (Abstract Device Interface) routines. ... The mpich/ref directory contains printable versions of the man pages for MPI and the ADI, in compressed PostScript form. The mpich/doc directory contains this Installation Guide and also the User's Guide . ... Центры . ...

Еще в разделе: (Показать все результаты (>547) - www.parallel.ru/ )

• Progress | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Obtaining and Unpacking the Distribution | PARALLEL.RU -
• File Consistency | PARALLEL.RU - Информационно-аналитический центр по

Below is a list of all of the modules that come as part of the Apache distribution. ... Access control based on client hostname or IP address . mod_actions Apache 1.1 and up . ... Sending files which contain their own HTTP headers . ... User authentication using text files . ... User authentication using Berkeley DB files . ... User authentication using DBM files . ... mod_browser Apache 1.2.* only . ... Replaced by mod_setenvif in Apache 1.3 and up . ... Support for HTTP header metafiles . ...

Еще в разделе: (Показать все результаты (>334) - oit.cmc.msu.ru/ )

• Installation
• readline_completion_function
• LDAP functions

Below is a list of all of the modules that come as part of the Apache distribution. ... mod_actions Apache 1.1 and up . ... Sending files which contain their own HTTP headers . ... User authentication using text files . ... User authentication using Berkeley DB files . ... User authentication using DBM files . ... mod_browser Apache 1.2.* only . ... Replaced by mod_setenvif in Apache 1.3 and up . ... Logging of User Agents . ... Replaced by the mod_log_config module in Apache 1.2 and up . ...

Еще в разделе: (Показать все результаты (>82) - neptun.sai.msu.ru/ )

• Definitions of terms used to describe Apache modules

... Gubkina 3, Moscow, 119991 Russia e-mail: johnnie_me@list.ru Distribution of genomic elements, i.e. segments of their increased or decreased density, may be related to DNA domains performing specific functions (e.g. CpG islands [1], clusters of transcription factor binding sites (TFBS) [2], or segments enriched or depleted in nucleosome binding sites [3]). ... Relative positions of conserved domains and nucleosomes in the proximal region of D.melanogaster even-skipped gene locus. ...

Еще в разделе: (Показать все результаты (>298) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/160.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/131.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/158.pdf

... Systematics and phylogeography of the steppe whiskered bat Myotis aurascens Kuzyakin, 1935 (Chiroptera, Vespertilionidae) . ... Phylogenetic relationships were examined among specimens identified as Myotis aurascens Kuzyakin, 1935 from across their distribution (Europe to the Korean Peninsula), and also among M. aurascens and other Myotis species. ... Литература Скачать PDF . ... The mammal fauna of Cat Ba Island, northern Vietnam . ...

Еще в разделе: (Показать все результаты (>1655) - zmmu.msu.ru/ )

• A preliminary study on genetic divergence of the Asian lesser white-toothed
• Two sympatric phylogroups of the Asian badger Meles leucurus (Carnivora:
• Taxonomy and distribution of the pikas (Ochotona, Lagomorpha) of

... Stability of three-layer finite difference-based lattice Boltzmann schemes" . Krivovichev G.V. and Mikheev S.A. Stability of three-layer finite difference-based lattice Boltzmann schemes is studied. ... The stability analysis with respect to initial conditions is performed. The Neumann method is used. ... Keywords: lattice Boltzmann method, lattice Boltzmann schemes, stability with respect to initial conditions, Neumann method. ...

Еще в разделе: (Показать все результаты (>404) - num-meth.srcc.msu.ru/ )

• "Mathematical modeling of the formation of suffocation conditions in shallow
• "Load balancing of processors when solving the problems of fluid and gas
• "Stationary distribution of product of matrices with random coefficients"

... Two-dimension linear regression model. ... The econometric modeling of time series . ... The course aims to provide students with basic models and methods of econometric modeling of financial time series. ... The course considers in detail the major methods of econometric modeling of time series, in particular modeling by stochastic processes, modeling of stationary and non-stationary time series, the spectrum analysis of time series. ... The problem of tax optimization under a given state budget. ...

Еще в разделе: (Показать все результаты (>9) - io.cmc.msu.ru/ )

Modules | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 . ... Core Features and Multi-Processing Modules . Other Modules . ... Multi-Processing Module implementing an exclusively threaded web server optimized for Novell NetWare . ... Multi-Processing Module allowing for daemon processes serving requests to be assigned a variety of different userids . ... This module provides for executing CGI scripts based on media type or request method. mod_alias . ...

Еще в разделе: (Показать все результаты (>378) - uneex.lorien.cs.msu.su/ )

• License agreement
• Meetings/Murray - UNИX
• GNU GENERAL PUBLIC LICENSE