... MPI_Comm_compare . ... All MPI routines in Fortran (except for MPI_WTIME and MPI_WTICK ) have an additional argument ierr at the end of the argument list. ierr is an integer and has the same meaning as the return value of the routine in C. In Fortran, MPI routines are subroutines, and are invoked with the call statement. ... All MPI routines (except MPI_Wtime and MPI_Wtick ) return an error value; C routines as the value of the function and Fortran routines in the last argument. ... Центры . ...

Еще в разделе: (Показать все результаты (>332) - www.parallel.ru/ )

Russian abstract] . Russian full text] . The classifications revealed by geometric morphometry and classical morphometry for Drosera rotundifolia , D. obovata , D. anglica and D. linearis were compared. ... the form of petiole middle part transverse section is the effective distinguishing character for the some different species and inter-species hybrids of Drosera ; . the consensus configurations are preferable for the geometric morphometry analysis of populations. ...

Еще в разделе: (Показать все результаты (>233) - herba.msu.ru/ )

• The behavior of Nymphaea flowers

CUTE . The Constrained and Unconstrained Testing Environment (CUTE) is a suite of Fortran subroutines, scripts and test problems for linear and nonlinear optimization. ... provide a way to explore an extensive collection of problems (over 800 different test problems to date); . provide a way to compare existing packages; . provide a way to use a large test problem collection with new packages; . ... CUTE is written is standard ANSI Fortran 77. ... SAL Home | Numerical Analysis | ...

Еще в разделе: (Показать все результаты (>9425) - www.sai.msu.su/ )

• SAL- Scientific Data Processing Visualization - Software Packages - EnSight
• SAL- Numerical Analysis - Optimization - HOPDM
• APOD: 2006 June 24 - Nix and Hydra

The method of gene expression analysis in complex morphological systems A.V. Klepikova, N.V. Demidenko, M.D. Logacheva, A.A. Penin M.V. Lomonosov Moscow State University, Moscow, Russia , annklepikova@gmail.com, demidenkonatalia@gmail.com, maria.log@gmail.com, alekseypenin@gmail.com Investigation of gene expression level is a powerful approach in functional genetics. ... 2010) Identification of genes correlated with early stage bladder cancer progression, Cancer Prev Res (Phila), 3(6):776­786. ...

Еще в разделе: (Показать все результаты (>302) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/17.pdf

Электронная библиотека Попечительского совета . ... Carstensen B. - Comparing and predicting between several methods of measurement . ... Название: Comparing and predicting between several methods of measurement . Автор: Carstensen B. Аннотация: . ... A model is presented for comparing several methods of measurement in the situation where replicate measurements by each method are available. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>113240) - lib.mexmat.ru/ )

• Lewis M. - Comparing, Designing, and Deploying VPHs :: Электронная библиотека
• Milelli M. - A Numerical Analysis of ConfinedTurbulent Bubble Plumes ::
• Friedman E., Gilley B. - Asia's Giants: Comparing China and India ::

... Take a particularly simple signal: a cosine wave. ... Now, we are going to stretch and shrink the wavelet along the time axis (we assume the data is in the time domain), and at each time compare the shape of the signal to that of the wavelet. ... Figure 3: The wavelet (dotted line) is translated rela tive to the signal (solid line). ... Figure 4: The dashed line plots the `match' between the wavelets (dotted line) and the signal (solid line) as a function of time. ...

Еще в разделе: (Показать все результаты (>2775) - crydee.sai.msu.ru/ )

• Analysis of a multiperiodic signal
• Image: Nijo castle, Shogun palace. The main building. Comparing to temples and

... The level of expression in Escherichia coli cells and different steps of purification of the recombinant NADP(+)-dependent formate dehydrogenase (EC 1.2.1.2, FDH) from bacterium Pseudomonas sp.101 was analyzed by rapid SDS-Gel capillary electrophoresis (SDS-Gel CE) and compared with SDS polyacrylamide gel electrophoresis (SDS PAGE). ... The molecular mass of the purified FDH was determined as 44,078 Da by matrix-assisted laser desorption/ ionisation time of flight mass spectrometry. ...

Еще в разделе: (Показать все результаты (>125) - www.enzyme.chem.msu.ru/ )

... In order to compare the number of different evolutionary stages obtained and X-ray luminosity of the chosen X-ray sources with the observed galactic values we use the sum of C/O+O/C , where C and O are the calculated and observed values of a given binary type, respectively. If we make comparison for a number of different binary species (for example, we compare the number of CV, number of X-ray pulsars,   total X-ray luminosity of LMXB, etc.), we write this criterion in the form: . ...

Еще в разделе: (Показать все результаты (>359) - xray.sai.msu.ru/ )

• Basic Observational Data for Determination of f(q) and

... We compared the possibilities of applying of two different kinetic models for the determination of reaction rate constants in micelles. ... The pseudophase model can be used to estimate the reaction kinetics in micelles only in cases b and c. If the decay deviates insignificantly from an exponential decay, the accurate determination of the rate constants from decay data will be virtually impossible by any of the discussed kinetic models. ...

Еще в разделе: (Показать все результаты (>967) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 49, No. 4, P. 251 (2008)
• The anomalous behaviour of the non-selective ionisation signal pulse under
• Moscow University Chemistry Bulletin Vol. 53, No. 3, P. 165 (2012)

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: tax of goods compared that Luxus. times. ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>4099) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Compare Shopping
• Экологический Форум - Фундаментальная Экология: Compare Prices Online
• Экологический Форум - Фундаментальная Экология: materials compared for yuan;

SVETKA, a program for analysis of different alignments . Back to the help page . ... Such a feature can look like " Leucine in the position 362 of the alignment of the entire family " and can, in many cases, be a "decision rule" to distinguish sequences from two sides of a tree branch. ... Comparing the alignment with an input tree (the tree may be entered by the user or reconstructed with the WPGMA algorithm), the program detects supporting positions of the alignment for every branch the tree. ...

Еще в разделе: (Показать все результаты (>58) - monkey.belozersky.msu.ru/ )

• About COGs

Canidae . ... Analysis of variation of the cheek teeth in three canid species (Mammalia: Canidae) by means of standard and geometric morphometrics Zoological Museum of Moscow University Several methods of minimizing size from overall variation are compared, which are shape variables of geometric morphometrics, two methods of data standardization (by character means and by specimen centroids), and principal component analysis. ... Rohlf, 1986; Bookstein, 1991; Navarro et al., ... 414 Canidae . ... Vol. ...

Еще в разделе: (Показать все результаты (>1256) - zmmu.msu.ru/ )

• Biochemical analysis of the metabolism of small rodents living in different
• Russian Journal of Theriology
• Epigenetic variation of the common shrew, Sorex araneus, in different habitats

PHP Manual . ... The switch statement is similar to a series of IF statements on the same expression. ... if ($i == 0) { print "i equals 0"; } if ($i == 1) { print "i equals 1"; } if ($i == 2) { print "i equals 2"; } switch ($i) { case 0: print "i equals 0"; break; case 1: print "i equals 1"; break; case 2: print "i equals 2"; break; } . ... Only when a case statement is found with a value that matches the value of the switch expression does PHP begin to execute the statements. ...

Еще в разделе: (Показать все результаты (>268) - oit.cmc.msu.ru/ )

• version_compare
• mcal_date_compare
• ldap_compare

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>453) - rtm-cs.sinp.msu.ru/ )

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>67) - brain.bio.msu.ru/ )

• Change-points in EEG components with different pattern
• Other prospects of the change-point based analysis
• Analysis of change-point synchronization in multi-channel EEG

... The documentation of NatSkin is crap. ... It does not work (on my TWiki/Cairo installation). ... Why is the sidebar switched off during edit? ... Why are the topic actions named differently compared to standard TWiki? Does NatSkin support QuietSave? ... NatSkin once supported TWiki-2 (Beijing), TWiki-3 (Cairo) and TWiki-4 (Dakar) but has dropped support for Beijing and Cairo since version 3.0. ... Most probably you clicked on "Save" which saved your changes but keept you in the edit process. ...

Еще в разделе: (Показать все результаты (>31371) - dualopt1.cmm.msu.ru/ )

• NatSkinTemplates - TWiki - TWiki
• NatSkinTemplates - TWiki - TWiki - (printable)
• %TOPICTITLE% (2 vs. 3) - TWiki

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>185) - www.genebee.msu.ru/ )

• Fasta3 help
• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services

... Further processing Only 3N events of «good» runs of previous analysis are selected: 3N triggered events exist in every run Better accordance with MC for rates 150kHz (see elog 548 by Colas) GC triggered events excluded AaFit: -6.5 (Vladimir's presentation explains reason) Zenith angle 20° (in order to look only at events with vertical tracks) After 2008 2009 2010 all fi year year year ltres: -- 0.83107 -- 0.77107 -- 1.04107 - No evidence of possible anisotropy either. ...

Еще в разделе: (Показать все результаты (>21) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf
• http://antares.sinp.msu.ru/docs/2010_Amsterdam_Kulikovskiy.pdf

... A New Jupiter Oval Rotates . ... 5.01.1999 . ... Credit: Galileo Project , JPL , NASA Explanation: Even Jupiter can do the twist. Large cloud systems on Jupiter rotate, and the newly formed oval pictured above is no different. This new oval formed earlier this year from the collision of two smaller ovals: an occurrence not unlike two large storms merging into one huge hurricane . ... Publications with keywords: oval clouds - Jupiter . Publications with words: oval clouds - Jupiter . ...

Еще в разделе: (Показать все результаты (>11148) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• An Orion of a Different Color
• Asteroids Near Earth

. You can compare any two versions of a file that is under the control of SCCS with the sccsdiff command: /usr/sccs/sccsdiff -r version -r version s. filename . Using this command produces a line by line difference between the two versions of the file. Results are shown in the same format as that produced by the diff command. Examples .

Еще в разделе: (Показать все результаты (>155) - comet.sai.msu.ru/ )

• Comparing directories
• Comparing files
• Examples of comparing files with the sccsdiff command