PHP Manual . ... The switch statement is similar to a series of IF statements on the same expression. ... if ($i == 0) { print "i equals 0"; } if ($i == 1) { print "i equals 1"; } if ($i == 2) { print "i equals 2"; } switch ($i) { case 0: print "i equals 0"; break; case 1: print "i equals 1"; break; case 2: print "i equals 2"; break; } . ... Only when a case statement is found with a value that matches the value of the switch expression does PHP begin to execute the statements. ...

Еще в разделе: (Показать все результаты (>1333) - oit.cmc.msu.ru/ )

• elseif

The %IF% construct gives TWiki the power to include content in topics based on the value of simple expressions. IF{"CONDITION" then="THEN" else="ELSE"}% . ... context . True if the current context is set (see below) . ... Check access permissions You %IF{"'%TOPIC%' allows 'change'" then="can" else="cannot"}% change this topic. ... in attach script (see TWikiScripts ) . ... in changes script (see TWikiScripts ) . ... in edit script (see TWikiScripts ) . ... in oops script (see TWikiScripts ) . ...

Еще в разделе: (Показать все результаты (>41238) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (5 vs. 6) - TWiki
• IfStatements - TWiki - TWiki

EnSight . EnSight is used by organizations worldwide for analyzing, visualizing and communicating computer-aided engineering and scientific research results. ... Parts - provides individual manipulation and attribute control of analysis mesh or derived (clip planes, isosurfaces, particle traces, etc.) parts . ... Quantitative Analysis/Data Query/Plotting . ... http://www.ensight.com . ... Available Binary Packages: . ... SAL Home | Scientific Data Processing Visualization | ...

Еще в разделе: (Показать все результаты (>9987) - www.sai.msu.su/ )

• SAL- Programming - Languages Compilers - Japhar
• Zen: SkyPixelization
• APOD: 2015 October 24 - Jupiter in 2015

DVM-system of parallel program development . Goals and structure . ... 2.1 C-DVM and Fortran DVM parallel program development . ... Using C-DVM and Fortran-DVM languages a programmer deals with the only version of the program both for sequential and parallel execution. ... These rules are syntactically organized in such a manner that they are "transparent" for standard C and Fortran compilers and doesn't prevent DVM-program execution and debugging on workstations as usual sequential program. ...

Еще в разделе: (Показать все результаты (>148) - sp.cs.msu.ru/ )

• DVM debugger. Preliminary design
• DVM debugger. Detailed design. Part 4
• Fortran DVM compiler. Detailed design

Электронная библиотека Попечительского совета . ... Beaulieu A. - Learning SQL . ... Название: Learning SQL . ... If you're working with a relational database - whether you're writing applications, performing administrative tasks, or generating reports - you need to know how to interact with your data. ... Learning SQL moves you quickly through the basics and then on to some of the more commonly used advanced features. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>21579) - lib.mexmat.ru/ )

• Koffman E. - Problem Solving and Structured Programming in PASCAL ::
• G?nther A. - Large-scale Structures in Rayleigh-Benard Convection and Flow Over
• Boillot M. - Basic Concepts and Structured Problem Solving :: Электронная

As conditional or control statements you have IF in many variants (but essentially not changed from Fortran 77), DO (with some new variants) and the completely new statement CASE . The DO- loop should now be ended with the statement END DO and we no longer need any statement number. In addition, we can use the statement EXIT to jump out of the DO -loop and CYCLE in order to go to the next iteration of the present DO -loop. ... all negative numbers WRITE (*,*) 'Negative number' CASE (0) ! ...

Еще в разделе: (Показать все результаты (>6409) - crydee.sai.msu.ru/ )

• Fortran 95
• Summary of Fortran 77 statements
• Heliophysics, Internal structure and seismology

LIPSKIY-RODIONOVA' LUNAR ANTIPODES AS PRECURSORS OF A REGULAR WAVE PLANETOLOGY G.G.Kochemasov IGEM of the Russian Academy of Sciences, Moscow, Russia kochem@igem.ru / Fax: (009)(095)230 21 79 The first observations of the lunar far side allowed to compare it with the near side and draw very important conclusions in the very beginning of planetary studies based on spacecrafts. ... Celestial bodies are dichotomic. ... The concept of celestial bodies includes Sun (a star) as one of them. ...

Еще в разделе: (Показать все результаты (>106) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Symposium/lipskiy.pdf

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>68) - brain.bio.msu.ru/ )

• Nonparametric approaches to the description of EEG piecewise stationary
• Change-points in multi-channel EEG

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>246) - www.genebee.msu.ru/ )

• GEA :: Gene Expression Analysis
• IGLA-3D User Guide

... Based on the systematic complex analysis of the knowledge accumulated up to the present, observed effects and established views in Electrodynamics, Quantum Mechanics and Theory of Relativity, it was found possible to suggest and develop a concept, according to which the global material corpuscular elastic medium (ether) exists in the environment, in which all objective processes and effects of the Megacosm, Macrocosm, and Microcosm take place. ...

Еще в разделе: (Показать все результаты (>515) - chronos.msu.ru/ )

• Russian Interdisciplinary Temporology Seminar
• A. P. LEVICH, A. V. SOLOV’YOV. CATEGORY-FUNCTOR MODELLING OF NATURAL SYSTEMS
• A. P. Levich

... The CompHEP Lagrangian tables do not describe explicitly the color structure of a vertex. ... for three color octets. ... Each vertex containing 4 color particles is split to 2 vertices which are joined by an automatically generated auxiliary field. ... Instead of evaluating this expression and that splitting all vertices independently, one can introduce one color octet auxiliary field and write this Lagrangian term as . ... enable vertex level splitting (only for vertices with 4 color particles). ...

Еще в разделе: (Показать все результаты (>1541) - theory.sinp.msu.ru/ )

• Structure of LanHEP input file
• General structure
• Omitting indices

case is a flow control construct that provides for multi-way branching based on patterns. ... This word is compared with each pattern in order until a match is found, at which point the associated command ( s ) are executed. case word in pattern1 ) command(s) ;; pattern2 ) command(s) ;; patternN ) command(s) ;; esac . When all the commands are executed control is passed to the first statement after the esac . ... A command can be associated with more than one pattern. ...

Еще в разделе: (Показать все результаты (>381) - comet.sai.msu.ru/ )

• The if statement
• Comparing files under SCCS control
• Did You Know?

Laboratories \ Laboratory of morphological adaptations of vertebrates \ Goals and Tasks . Goals and Tasks . ... The head of Laboratory . ... Research tasks : 1) to show a wide polymorphism in the structure of the systems of organs at different levels of their organization; 2) to analyze an adaptive nature of the structure of the systems of organs, using morphological functional analysis; 3) on the basis of the methods of comparative morphology, to reveal analogical, homological, ...

Еще в разделе: (Показать все результаты (>7721) - www.sevin.ru/ )

• Laboratories: Laboratory for Soil Ecological Functions: Goals and Tasks
• Scientific programs and projects: Evaluation of consequences of influences
• Laboratories: Group for Bioinformatics and Modeling Biological Process: Results

... Building Packages for Multiple Architectures and Operating Systems . ... The key to exerting this kind of platform-specific control in the spec file is to use RPM's conditionals. ... The first thing is that conditionals are block-structured. ... ifos Linux Summary: This is a package for the Linux operating system %endif . ... ifarch i386 echo "This is an i386" %ifos Linux echo "This is a Linux system" %else echo "This is not a Linux system" %endif %else echo "This is not an i386" %endif . ...

Еще в разделе: (Показать все результаты (>2437) - uneex.lorien.cs.msu.su/ )

• Conditionals
• They're Nearly Identical?
• Configuration Sections - Apache HTTP Server

... The goal of our work was to study the particularities of the flower behavior of Nymphaea candida L. To reach this goal we marked these problems: . 1)To study the dynamics of the behavior of Nymphaea candida flowers. 2)To find the factors which cause the rhythmic behavior of the flowers and intensity of the bloom of Nymphaea candida . ... 4)To compare published material on biological rhythms of different plant species with our material on the behavior of Nymphaea candida flowers. ...

Еще в разделе: (Показать все результаты (>713) - herba.msu.ru/ )

• Insect catching and carnivorous plants
• The variability of different Drosera
• The employment of quantitative methods for the lake ecosystem research

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... DRIVER: To develop a model of the interstellar hydrogen distribution in the heliosphere. To apply this model for the analysis of experimental data from different spacecraft. ... The results of the simulations of the formation and evolution of molecular clouds can be used as initial conditions for the current star formation in galaxies. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• APPLICATIONS: Theoretical Physics | Moscow University Supercomputing Center
• APPLICATIONS: Mathematics | Moscow University Supercomputing Center
• APPLICATIONS: Condensed Matter Physics | Moscow University Supercomputing...

Atom subtypes present in protein structures: introducing dynamic atom similarity measure. ... St.Petersburg, 199034, Russia, gm2124@mail.ru Keywords: Atom subtypes, covalent bond lengths, protein structure. ... The cause of this issue is purely combinatorial, because if we treat each of the 20 aminoacids' heavy atoms as being of its own subtype, that leaves us with 167 different atom types, which in turn gives thousands of parameters to estimate even in a simple case of two atom interactions. ...

Еще в разделе: (Показать все результаты (>324) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/48.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/33.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/101.pdf

... IDL typedef octet Bytes[64]; struct S { long len; }; interface A; union U switch (long) { case 1: long x; case 2: Bytes y; case 3: string z; case 4: case 5: S w; default: A obj; }; . ... Unions map to C++ classes with access functions for the union members and discriminant. ... For union Z , calling the _default() member function causes the union's value to be composed solely of the discriminator value of FALSE , since there is no explicit default member. ...

Еще в разделе: (Показать все результаты (>803) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_include
• Apache module mod_access
• Linux Threads Home Page: How do Linux Threads compare with other OSs'?

... What is an intelligence or an intelligent life? ... Various particular cases, new regimes, original approaches etc. being attractive as they could, all this is a pale shade of a real process of cognition. ... May an infinitely complicated object be indeed so simple? ... An intelligence could not arise in an infinitely complicated universe! ... There are two possibilities: whether our imagination of infinitely complicated object is incorrect or the surrounding world is not infinitely complicated. ...

Еще в разделе: (Показать все результаты (>531) - xray.sai.msu.ru/ )

• Nomenclature
• Basic Observational Data for Determination of f(q) and
• Super Ratio

S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>5503) - monkey.belozersky.msu.ru/ )

• ETS_3D_conservation
• Inquiry information || Rule of four sequences
• Homeodomain numeration assumed