... Small proteins . ... Zn-binding ribosomal proteins . ... Ribosomal protein L32p . protein domain . ... Escherichia coli [TaxId: 562] . ... Thermus thermophilus [TaxId: 274] . ... Deinococcus radiodurans [TaxId: 1299] . ...

Еще в разделе: (Показать все результаты (>6314) - monkey.belozersky.msu.ru/ )

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>297) - npidb.belozersky.msu.ru/ )

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• Comparison of protein phylogeny reconstruction methods

... Другие названия журнала: Protein Expr Purif , Protein Expr. ... Zakharova G.S. , Poloznikov A.A. , Chubar T.A. , Gazaryan I.G. , Tishkov V.I. в журнале Protein Expression and Purification , издательство Academic Press (United States) , том 113, ? ... в журнале Protein Expression and Purification , издательство Academic Press (United States) , том 90, ? ... 2012 Expression, purification and some properties of fluorescent chimeras of human small heat shock proteins Protein Expr Purif . ...

Еще в разделе: (Показать все результаты (>1328) - istina.msu.ru/ )

• Proteins: Structure, Function and Bioinformatics - журнал | ИСТИНА -
• Biochimica et Biophysica Acta - Proteins and Proteomics - журнал | ИСТИНА -
• Protein Engineering, Design and Selection - журнал | ИСТИНА - Интеллектуальная

... Белок-рецептор циклического аденозинмонофосфата (catabolite gene activator, cAMP receptor protein, cAMP-regulatory protein) . ... uniprot-Taxonomy:Archaea*] (((([uniprot-Description:Catabolite*] [uniprot-Description:gene*]) [uniprot-Description:activator*]) | uniprot-Description:cAMP*] [uniprot-Description:receptor*]) [uniprot-Description:protein*])) | ... uniprot-Taxonomy:Bacteria*] (((([uniprot-Description:Catabolite*] [uniprot-Description:gene*]) [uniprot-Description:activator*]) | ...

Еще в разделе: (Показать все результаты (>3398) - kodomo.cmm.msu.ru/ )

• Protein 1QGD
• About protein 1HQ1
• Protein Structure of HSLU_ECOLI

... Properties of the monomeric form of human 14-3-3zeta protein and its interaction with tau and HspB6. ... Using WMW and MMW mutants, we show that the monomeric form interacts with the tau protein and with the HspB6 protein, in both cases forming complexes with a 1:1 stoichiometry, in contrast to the 2:1 and/or 2:2 complexes formed by wild-type 14-3-3. Significantly, this interaction requires phosphorylation of tau protein and HspB6. ...

Еще в разделе: (Показать все результаты (>112) - biochem.bio.msu.ru/ )

• Reduction of photosystem I reaction center by recombinant DrgA protein in
• Protection of proteins from oxidative stress: a new illusion or a novel
• Erythrocyte and plasma protein modification in alcoholism: a possible role of

... Scanning probe microscopy (SPM) allows the visualization of single protein molecules and their complexes with membranes. ... Antibodies . ... Self-assembly in protein-membrane systems . ... Self-assembled nanostructures form from membrane proteins, e.g. ATP-syntase and cytochrome P450 [5]. ... Kiselyova O.I., Yaminsky I.V. "Proteins and memrane-protein complexes" in Scanning Probe Microscopy of Biopolymers (Ed. by Yaminsky I.V., Scientific World, Moscow, 1997) p. 41. (in Russian). ...

Еще в разделе: (Показать все результаты (>45) - www.spm.genebee.msu.ru/ )

• INTAS-01-0045
• AFM OF RNA AND RNA-PROTEINS COMPLEXES
• Igor Yaminsky's homepage

Protein Explorer . The Protein Explorer (PE) enables you to view and explore the three-dimensional (3D) structure of any macromolecule. You can explore proteins, DNA, RNA, carbohydrates, and complexes, such as between transcriptional regulatory proteins and DNA, or enzymes and drugs. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>82) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - Protein Structure
• SAL- Other Scientific Fields - Chemistry, Biology Related - BRAGI
• SAL- Other Scientific Fields - Chemistry, Biology Related - E-Cell

Group "Biomedical applications for proteins and enzymes. Pharma Biotechnology" . ... Associate Professor Babusenko E.S. (Protein encapsulation) http://www.muctr.ru/univsubs/infacol/ekolog/faculties/f3 . ... Professor Shvetz V.I. , associate Professor Sorokoumova G.M. (Lipid- based protein delivery systems) http://www.mitht.ru . ... Scryabin Moscow Academy of Veterinary Medicine and Biotechnology, Professor Belousova R.V. (Antiviral action of protein preparations) http://www.mgavm.ru . ...

Еще в разделе: (Показать все результаты (>118) - www.enzyme.chem.msu.ru/ )

• Genetic and Protein Engineering Group
• Members of Genetic and Protein Engineering Group
• Group of Genetic Engineering and Protein Design

Sorex araneus . Temporal and spatial distribution of Rad51 protein in spermatocytes of the common shrew Sorex araneus L. (Soricidae, Eulipotyphla) . ... We used antibodies against human Rad51 to examine the temporal and spatial distribution of Rad51 in the spermatocytes of the common shrew Sorex araneus (Eulipotyphla, Soricidae). ... Synaptonemal complexes of the common shrew Sorex araneus L. in spermatocyte spreads // Cytogenetics and Cell Genetics. ... Chromosomes of the common shrew // Nature. ...

Еще в разделе: (Показать все результаты (>77) - zmmu.msu.ru/ )

... PYRB_ECOLI 51 EASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYV 100 PYRB_VIBCH 101 DAFVMRHPQEGAARLASEFSNGVPVINAGDGSNQHPSQTLLDLYSIFETQ 150 || PYRB_ECOLI 101 DAIVMRHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQETQ 150 PYRB_VIBCH 151 GRLDNLDVAFVGDLKYGRTVHSLAQALAKFDNNRFYFVAPEALAMPDYIC 200 || PYRB_ECOLI 151 GRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYIL 200 PYRB_VIBCH 201 EELDEAGVKYQVFSDMESVIPELDILYMTRVQKERFDESEYAHIKSAYIL 250 :.| ...

Еще в разделе: (Показать все результаты (>14901) - kodomo.fbb.msu.ru/ )

• allpy: 4a9b4503a027 allpy/protein.py
• allpy: faa7e19bffd9 allpy/protein.py
• allpy: c4c772e3ce86 allpy/protein.py

Development of inhibitors of human and Mycobacteium tuberculosis serine/threonine protein kinases as promising agents for treatment of various diseases , from type II diabetes to Alzheimer's disease . Protein kinases are enzymes playing a key role in many therapeutically significant signal pathways. ... Des. ... Drug Des. 2011, 78, 378-390 . ... 2011, 30, 169-180 . ... Serine/threonine protein kinases . ... 2016 Laboratory of Medicinal Chemistry ...

Еще в разделе: (Показать все результаты (>7) - qsar.chem.msu.ru/ )

• Research - Laboratory of Medicinal Chemistry

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>196) - www.genebee.msu.ru/ )

• Laboratory of protein synthesis regulation
• INTAS :: Global and Local Protein Matching
• Screening of pattern or alignment against PROTEIN databank

of the division of CHEMISTRY OF NATURAL COMPOUNDS . Veronika V. Anisimova , Junior researcher . Galina N. Balandina , Associate Professor . ... Galina I. Lavrenova , Associate Professor . Elena N. Lysogorskaya , Senior researcher . Elena S. Oksenoit , Researcher . Galina N. Rudenskaya , head of research group . Natalya V. Sumbatyan , Junior researcher . List of other divisions and laboratories of the Chemistry Department . Home Page of the Chemistry Department ...

Еще в разделе: (Показать все результаты (>234) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 52, No. 2, P. 113 (2011)
• Moscow University Chemistry Bulletin Vol. 42, No. 5, P. 355 (2001)
• Moscow University Chemistry Bulletin Vol. 55, No. 3, P. 158 (2014)

Электронная библиотека . ... Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . ... Поиск по указателям . Результат поиска . Книга . Страницы для поиска . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>709) - lib.mexmat.ru/ )

• Gelb M.H. - Protein Lipidation Protocols :: Электронная библиотека
• Fu H. - Protein-Protein Interactions. Methods and Applications :: Электронная
• Zhang A. - Protein interaction networks: computational analysis :: Электронная

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1B01 . GENE REGULATION/DNA . 2 . 2 . 1EA4 . GENE REGULATION/DNA . 10 . 10 . 2HZV . METAL BINDING PROTEIN/DNA . 8 . 8 . total (3 entries) . 20 . 20 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>6508) - mouse.belozersky.msu.ru/ )

• Cluster 3
• Cluster 29
• MTPro

... Many protein families contain homologous proteins that have a common biological function but different specificity. Given a multiple sequence alignment of a family divided into specificity groups, SDPpred predicts a set of alignment positions ( SDP, Specificity-Determining Positions ) that determine differences in the functional specificity. ... 2004) Automated selection of positions determining functional specificity of proteins by comparative analysis of orthologous groups in protein families. ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• SDPlight
• SDPsite

Protein docking algorithm based on structural homology with protein-protein interfaces T. Kirys, A.V. Tuzikov United Institute of Informatics Problems, National Academy of Sciences of Belarus, Surganova, 6, Minsk, tuzikov@newman.bas-net.by An original protein docking algorithm based on structural similarity with experimentally determined protein-protein interfaces is proposed. ... The alignment is performed by dynamic programming on distance matrices of protein and interface. ...

Еще в разделе: (Показать все результаты (>189) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/157.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/126.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/107.pdf

... Esipova N.G. , Lobachev V.M. , Tumanyan V.G. , Davidova L.I. 1 , Fedoruk K.V. 1 , Bogush V.G. 1 , Debabov V.G. 1 . ... CD-study of the recombinant proteins of spidroin I and spidroin II type recovers poly-lproline II left-helical conformation as basic structure of this protein. This type conformation was found for the first time in b-structural silks. We observe isobestic point at the CD-curves of water solutes of the recombinant proteins at various concentrations. ... 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>38) - www.msm.biophys.msu.ru/ )

Computation of contribution from the cavity effect to protein-ligand binding free energy" . Grigoriev F.V., Jabin S.N., Romanov A.N., Sulimov V.B. Some results of the study of the cavitation effect, which provides an essential part of hydrophobic interactions due to the formation of protein-ligand complexes, are discussed. ... The main contribution to the cavitation effect is due to the annihilation of the cavity of the ligand. ... PostScript (in Russian) (14.1MB) . PDF (in Russian) (697KB) . ...

Еще в разделе: (Показать все результаты (>10) - num-meth.srcc.msu.ru/ )

• "An algorithm of assigning the force parameters to atoms of organic molecules