S .. ... a database of structures of DNA-protein and RNA-protein complexes. ... a program for finding hydrophobic clusters in 3D structures of macromolecules . ... search of conserved hydrophobic clusters in aligned 3D structures of protein families . ... a program for analysis of multiple alignments . ... a program for automatic detection of aligned blocks in a multiple protein alignment. ... a program for detection of aligned blocks in a multiple alignment of sequences of PDB chains. ...

Еще в разделе: (Показать все результаты (>6408) - monkey.belozersky.msu.ru/ )

• About authors ot this complex
• S publications

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6975) - mouse.belozersky.msu.ru/ )

... 4 from monomer import AminoAcidType . ... 21 * name -- str with the name of sequence . ... 44 def __init__ ( self , monomers = None , name = '' , description = "" ): . ... 102 def from_str ( fasta_str , name = '' , description = '' , monomer_kind = AminoAcidType ): . ... 191 def pdb_has ( self , chain , monomer ): . ... 194 def secstr_has ( self , chain , monomer ): . ... 198 def file_slice ( file , n_from , n_to , fasta_name = '' , name = '' , description = '' , monomer_kind = AminoAcidType ): . ...

Еще в разделе: (Показать все результаты (>43219) - kodomo.fbb.msu.ru/ )

• allpy: b520e79fd1f4 allpy/markups.py
• allpy: 835efa2a8c71 test/usecase1.py
• allpy: 835efa2a8c71

Электронная библиотека Попечительского совета . ... Pap E. - Complex Analysis Through Examples And Exercises . ... Название: Complex Analysis Through Examples And Exercises . Автор: Pap E. Аннотация: . This volume on complex analysis offers an exposition of the theory of complex analysis via a comprehensive set of examples and exercises. ... Complex number 1 . ... Hadamard example 63 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>17185) - lib.mexmat.ru/ )

• Char B.W. - First Leaves: A Tutorial Introduction to Maple V :: Электронная
• Lathrop R.H., Rogers Jr R.G., Smith T.F. - A Bayes-optimal sequence-structure
• Neder R.B., Proffen T. - Diffuse Scattering and Defect Structure Simulations: A

... Master Education . ... Master programs . ... Master program "Mathematical Models of Complex Systems: Theory, Algorithms, Applications" . ... The Mathematical Models of Complex Systems: Theory, Algorithms and Applications Master?s programme is aimed at studying the foundations of computational methods and software for new types of current problems in modelling, decision-making, and control of complex systems. ... Второе высшее образование: second_edu@cs.msu.ru, 6-й этаж, комната 640, тел. ...

Еще в разделе: (Показать все результаты (>130) - hcs.cmc.msu.ru/ )

Additional topic data, program-generated or from TWikiForms , is stored embedded in the topic text using META: tags . ... Meta Data Syntax . Meta Data Specifications . ... META:FORM . ... By default, TWiki stores topics in files on disk, in a really simple and obvious directory structure. ... Order of fields within the meta variables is not defined, except that if there is a field with key name , this appears first for easier searching (note the order of the variables themselves is defined). ...

Еще в разделе: (Показать все результаты (>41107) - dualopt1.cmm.msu.ru/ )

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>147) - bioinf.fbb.msu.ru/ )

• Input Formats
• SDPsite - Gallery of examples
• SDPsite

Sequence alignment of non-superposable beta-sheets Evgeniy Aksianov Belozersky Institute, Lomonosov Moscow State University, Leninskie Gori 1, Moscow, Russia, evaksianov@gmail.com Andrey V. Alexeevski Belozersky Institute, Lomonosov Moscow State University, Scientific Research Institute for System Studies (NIISI RAN), Moscow, Russia aba@belozersky.msu.ru Protein 3D structures usually are more conserved than their sequences. ... Beta-strands are contained in sheet map rows. ...

Еще в разделе: (Показать все результаты (>349) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/126.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/179.pdf
• MCCMB'11 program

CALCSYM - complex evaluator . ... CALCSYM.exe and CALCSYMi.exe will allow you to obtain numeric solution for *.out file generated by both CIRSYM and MATSYM programs (computation of freqency responces, unknowns, determinants, sensitivity analysis etc.. ... Setup file name for CALCSYM is "setup.cal". ... CALCSYMi.exe will allow you to work with long double over the range from 3.4*E-4932 to 3.4*E+4932. ... To calculate, run CALCSYM.exe and enter "file_name.OUT" or click on the "ENTER" (in "OUT" case). ...

Еще в разделе: (Показать все результаты (>17) - astrometric.sai.msu.ru/ )

• Specification

... About lab . ... MSU Graphics & Media Lab (Video Group) . The algorithm allows to increase video frame rate (fps) by the factor equal to any integer number. ... Frame rate conversion is done as shown on the picture below: . Frame rate conversion scheme . ... arbitrary whole number of interpolated frames between reference frames. ... Explicit scheme of occlusions detection improves visual quality of interpolated frames in areas near the frame edges. ... Video Frame Rate Double Up-Conversion . ...

Еще в разделе: (Показать все результаты (>861) - graphics.cs.msu.ru/ )

• High-quality video resolution enhancement | Graphics and Media Lab
• Hide information in video | Graphics and Media Lab
• Removing of blocking effect from video | Graphics and Media Lab

The existence of oceanic islands and seamounts is supposed to be the one of the main evidence of the plate tectonic theory. But there is no such acient geological object which could be so similar to rock complex of oceanic island. These structures must include the alkaline magmatism manifestation, sedimentary rocks close to recent riff limestone on the oceanic islands and sequence of terrigenic rocks. ... 100.00 . ... H 2 O calculated by the 100% norm of cations. d.l.. ...

Еще в разделе: (Показать все результаты (>1059) - geo.web.ru/ )

• Второе приглашение на научно-практическую конференцию "Современные методы

... Postulates and hypothesises during Standard Solar Model construction. Main course - an evolution of hydrogen abundance. Main work - a sequence of stationary models. What is a stationary model - postulates of . a) dynamic equilibrium, . b) local enegry conservation (existence of enegry sourse), . ... Equilibrium of gravity and gas pressure . ... Gradient of sound speed. ... Equation for pressure disturbace as result of sound speed changes (liniarization of hydrostatic equation) . ...

Еще в разделе: (Показать все результаты (>2640) - crydee.sai.msu.ru/ )

• Heliophysics, Internal structure and seismology
• Tutorial on Fortran 90, Digital UNIX
• Use of program libraries

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... LOBKOVSKII E.B. , SIZOV A.I. , BULYCHEV B.M. , SOLOVEICHIK G.L. в журнале Journal of Organometallic Chemistry , издательство Elsevier BV (Netherlands) , том 319, ? ... LOBKOVSKII EB , SOLOVEICHIK GL , BULYCHEV BM , GERR RG , STRUCHKOV YT . ...

Еще в разделе: (Показать все результаты (>5127) - istina.msu.ru/ )

• Frenkiel T.A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Obridko S.V. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Goode B.L. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... Nucleotide sequences Protein sequences Protein structures Protein signatures Literature Protein seq's [SRS] . ... Summary Table . ... Ribose operon repressor. 326 . ... HTH-type transcriptional regulator regA. 332 . ... Ribose operon repressor. 329 . ... HTH-type transcriptional regulator galR (Galactose operon repressor). 342 . ... HTH-type transcriptional regulator galR (Galactose operon repressor). 343 . ... HTH-type transcriptional regulator malR (Maltose operon transcriptional repressor). 344 ....

Еще в разделе: (Показать все результаты (>5910) - kodomo.cmm.msu.ru/ )

• Conservative Amino Acid Residues
• Structure Alignment

... Give an example of chemical reaction between a salt and an acid leading to the formation of another salt and a base. (1 point) [Solution] . ... Write the reactions of chromium (III) bromide with hydrogen peroxide in acidic and basic media. (2 points) [Solution] . ... In the reactions, specify the structures of all substances. (3 points) [Solution] . ... Three substances A, B, and C were mixed in the amount of three moles each. ... Example problems in chemistry for the entrance exams ( main round ) ....

Еще в разделе: (Показать все результаты (>1000) - chem.msu.ru/ )

• Entrance Examinations
• Structure and Interaction Energies of the Ar...Cl2 Complex. Application of the
• Moscow University Chemistry Bulletin Vol. 52, No. 6, P. 443 (2011)

Next: SYSTEM CALL: msgget() Up: Internal and User Data Previous: Kernel msqid_ds structure . The kernel stores permission information for IPC objects in a structure of type ipc_perm . ... struct ipc_perm { key_t key; ushort uid; /* owner euid and egid */ ushort gid; ushort cuid; /* creator euid and egid */ ushort cgid; ushort mode; /* access modes see mode flags below */ ushort seq; /* slot usage sequence number */ }; . ... Finally, the slot usage sequence number is stored at the end. ...

Еще в разделе: (Показать все результаты (>545) - itpm.msu.su/ )

• Dialing out with chat
• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL
• mod_dav - Apache HTTP Server

To get a single file from a remote host: ftp> get news . This transfers a copy of the file news from the current directory on the remote host to your current directory on the local host. If you don't give a local filename the filename of the remote file you are copying is used to name the local file. To get a file from a subdirectory on the remote host: ftp> get reports/quarterly/march tmp/month3 . ... To get several files from a remote host: ftp> mget *.ps . ...

Еще в разделе: (Показать все результаты (>576) - comet.sai.msu.ru/ )

• Examples of sending files with the ftp program
• Examples of changing environment variables: Bourne shell
• Examples of changing environment variables: BASH shell

... Applications of Molecular Mechanics to Metal Complexes" . ... Molecular mechanics study of the mixed-ligand lanthanide complexes using Gillespie-Kepert model . ... Within MM-GK, the same parameters are applicable to complexes of different coordination numbers/polyhedra. ... Gillespie-Kepert model . ... Using derived computational parameters, we calculated the geometry of 39 lanthanide ion nonaaqua complexes, 6 octaaqua complexes and 18 beta- diketonate and aqua-beta-diketonate complexes. ...

Еще в разделе: (Показать все результаты (>36) - analyt.chem.msu.ru/ )

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>62) - brain.bio.msu.ru/ )

• Change-points in multi-channel EEG
• Nonparametric approaches to the description of EEG piecewise stationary
• Change-points at different levels of the hierarchy of EEG segmental...

... Invariant complex structures on generalized symmetric spaces Svjetlana Terziґ c University of Montenegro joint work with Dieter Kotschick (LMU - Munich) 1 1. ... In particular, if H is centralizer of a torus in G than G/H admits an invariant almost complex structure. ... On the numb er of invariant (almost) complex structures Thm 4 (Borel-Hirzebruch) Isotropy representation for G/H decomp oses into t irreducible summands G/H admits exactly 2t invariant almost complex structures. ...

Еще в разделе: (Показать все результаты (>210) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/people/taras/talks/2005canberra-talk.pdf
• http://higeom.math.msu.su/~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/2011/Mishchenko-Ribeiro-1102.5698v1.pdf
• http://higeom.math.msu.su/people/taras/talks/2007novosibirsk-talk.pdf