D.Moss, D.Sokoloff, R.Beck, Ram pressure effects in the galactic plane and galactic dynamos in the no-z approximation, Astron. Astrophys., 544, A5, 4 pages, 2012 . ... To isolate the leading physical effects, we exploit a simple dynamo model that can describe relevant effects. ... Any determination of galactic motion through the cluster medium from observational data needs to take the effects of dynamo action into account. ...

Еще в разделе: (Показать все результаты (>74) - srcc.msu.ru/ )

• Moss D., Sokoloff D., Beck R., Ram pressure effects in the galactic plane and
• Arshakian T. G., Stepanov R., Beck R., Krause M., Sokoloff D. Simulations of
• D.Moss, D.Sokoloff, Magnetic field reversals and galactic dynamos, arXiv:

Электронная библиотека Попечительского совета . ... Kruegel E. - The Physics of Interstellar Dust . ... Название: The Physics of Interstellar Dust . Автор: Kruegel E. Аннотация: . ... Also discussed are the roles dust plays in star formation and the spectral appearance of protostars and dusty galactic nuclei." ... Diffuse interstellar medium 218ff 274 389 392ff . ... Interstellar extinction curve see "Reddening curve" . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>4394) - lib.mexmat.ru/ )

• Alloin D., Johnson R., Lira P. - Physics of Active Galactic Nuclei at all
• Kirk J., Melrose D., Priest E. - Plasma astrophysics :: Электронная библиотека
• Palen S. - Schaum's Outline of Astronomy :: Электронная библиотека

... Program of the Course of Radio Astronomy . Moscow State University , Physics Department , Astronomy Division , 4 th year, 60 hours in total) . ... Molecular maser emission. ... The emission of the interstellar neutral hydrogen. ... Pacholczyk, A. G. Radio Astrophysics, W. H. Freeman & Co., ... Frontiers of Astrophysics, Avrett, E. H., ed., Harvard University Press, Cambridge, Mass., ... Kaplan, S. A., Pikelner, S. B. The Interstellar Medium, Harvard University Press, Cambridge, Mass., ...

Еще в разделе: (Показать все результаты (>40) - comet.sai.msu.ru/ )

• Molecular Masers

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>222) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... Hildebrand R. H. The determination of cloud masses and dust characteristics from submillimetre thermal emission // Quart. ... Astron. ... Vol. ... Зинченко И. И., Кисляков А. Г. Поиск и исследование конденсаций звездообразования в темных галактических туманностях // Спектральные исследования космического и атмосферного излучения. ... Draine B. T., Lee H. M. Optical properties of interstellar graphite and silicate grains // Astrophys. ... J. 2002. ... Публикации с ключевыми словами: Межзвездная пыль ...

Еще в разделе: (Показать все результаты (>15833) - www.astronet.ru/ )

• Galactic Supernova Remnant IC 443
• Астронет > Galactic Supernova Remnant IC 443
• XWare > APOD

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Moss D. , Stepanov R. , Krause M. , Beck R. , Sokoloff D. в журнале Astronomy and Astrophysics , издательство Springer Verlag (Germany) , том 578, с. 94-7 DOI . ... Moss D. , Sokoloff D. , Beck R. , Krause M. в журнале Astronomy and Astrophysics , издательство Springer Verlag (Germany) , том 566, с. A40 DOI . ...

Еще в разделе: (Показать все результаты (>4978) - istina.msu.ru/ )

• Berezhko E.G. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Stefani G. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Da Pieve F. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... The molecular content of the DMTau and GGTau disks . ... 317, P L55-L58 (1997). ... Article in PDF format . ... 317, P L59-L62 (1997). ... 317, P L63-L66 (1997). ... 317, P L67-L70 (1997). ... 317, P L71-L74 (1997). ... 317, P L75-L78 (1997). ... 317, P L79-L81 (1997). ... 317, P 303-317 (1997). ... 317, P 318-327 (1997). ... 317, P 328-349 (1997). ... 317, P 350-357 (1997). ... 317, P 358-384 (1997). ... 317, P 385-392 (1997). ... 317, P 393-396 (1997). ... helpdesk@link.springer.de . ...

Еще в разделе: (Показать все результаты (>398) - crydee.sai.msu.ru/ )

• Springer LINK:A&A-EE: Table of Contents Volume 317 Number 3 (1997)
• Springer LINK:A&A-EE: Table of Contents Volume 328 Number 2 (1997)
• Springer LINK:A&A-EE: Table of Contents Volume 333 Number 3 (1998)

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>67) - num-meth.srcc.msu.ru/ )

• "Galactic dynamo equations with random coefficients"

. E. Swedenborg (from "Heavenly City") . List of scientific publications . List of preprints in the ArXiv . Lectures etc. (*.ppt) . My CV . Photos . Old version of the HomePage . Our paper . on the cover of . A . Phone: +7 (495) 939-50-06 . Review (in Russian); Poster on CNOC3: Gould Belt; Poster for SN1604: kicks.

Еще в разделе: (Показать все результаты (>562) - xray.sai.msu.ru/ )

• Сергей Попов
• ADS Abstract Service Results
• Frequency distribution of galactic binaries

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... DRIVER: To develop a model of the interstellar hydrogen distribution in the heliosphere. To apply this model for the analysis of experimental data from different spacecraft. ... The results of the simulations of the formation and evolution of molecular clouds can be used as initial conditions for the current star formation in galaxies. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>27) - hpc.msu.ru/ )

• APPLICATIONS: Plasma Physics | Moscow University Supercomputing Center

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>23) - mouse.genebee.msu.ru/ )

• ConClus
• Nhunt: program for nucleic acid sequence similarity search

Gamma-rays above 10 TeV Dieter Horns ­ University Hamburg RXJ1713-3946 [HESS Coll. ... The indirect path to the accelerator sky Dieter Horns ­ University Hamburg Is it a good deal? [astro-ph/0607109] Unveiling Cosmic Ray accelerators: Interstellar medium ( B-field + gas + photons) Accelerated Nuclei Meson production via inelastic scattering Gamma-rays , Neutrinos Cosmic rays Neutral particles (photons neutrinos) retain directional information: Accelerator sky Charged particles ( ...

Еще в разделе: (Показать все результаты (>7) - tunka.sinp.msu.ru/ )

• http://tunka.sinp.msu.ru/en/presentation/Ptuskin.pdf
• http://tunka.sinp.msu.ru/en/presentation/Zirakashvili.pdf

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6976) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>231) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf

... 2006 February 13 . The N44 Emission Nebula . ... Located in our galactic neighbor the Large Magellanic Cloud , N44 houses numerous massive bright stars, lengthy lanes of dark dust , and vast clouds of hydrogen gas that glows red. The red color of the N44 emission nebula comes from pervasive hydrogen atoms re-acquiring electron s that were knocked away by energetic light from massive stars. ... N44, pictured above , spans about 1,000 light years and lies about 170,000 light years distant. ...

Еще в разделе: (Показать все результаты (>2465) - www.sai.msu.su/ )

• APOD: July 21, 1999 - Galactic Supernova Remnant IC 443
• APOD: 2000 September 16 - X-Ray Earth
• APOD: 2001 October 23 - Emission and Reflection in NGC 6559

... Protein sequences . ... European ribosomal RNA database . ... Thermodynamic database for protein-nucleic acids interactions (Japan) . ... Families of structurally similar proteins . ... Database of protein families and HMMs (collection of multiple sequence alignments and hidden Markov models) . ... Collection of protein families constructed by clustering complete protein sequences. ... Database issues of NAR: vol. 31 (2003) , vol. 32 (2004) , vol. 33 (2005) , vol. 34 (2006) , vol. 35 (2007) , vol. ...

Еще в разделе: (Показать все результаты (>238) - monkey.belozersky.msu.ru/ )

• SDP home page
• ETS_all_contacts alignment
• Inquiry information || Formats of alignments

... Faculty of Physics . ... 7 (495) 939-16-82 info@physics.msu.ru . ... Second harmonic generation in metamaterials with magnetodipole resonance . ... Konstantin Zhukovsky (Faculty of Physics, Department of Theoretical Physics, MSU) gave complete analytical description of the harmonic generation in undulators with accurate account for all major losses in real devices and demonstrated how the electron beam emittance can be compensated by properly imposed constant magnetic field. ... 7 495 939-16-82, . ...

Еще в разделе: (Показать все результаты (>175) - phys.msu.ru/ )

astro-ph/0307410 Молекулярный газ в материнской галактике квазара на красном смещении z=6.42 (Molecular Gas in the Host Galaxy of a Quasar at Redshift z=6.42) . ... Authors: R. Klein et al. astro-ph/0307223 Скопление галактик, спрятавшееся за М31:наблюдения RX J0046.4+4204 на XMM-Newton (A Cluster of Galaxies hiding behind M31: XMM-Newton observations of RX J0046.4+4204) . ... обзор hep-ph/0307284 Проверки закона обратных квадратов в гравитации (Tests of the Gravitational Inverse-Square Law) . ...

Еще в разделе: (Показать все результаты (>511) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/obzors.html
• Обзоры препринтов astro-ph

... Biographical sketch . ... Selected Publications . ... Buchachenko is one of the founders and leaders in spin chemistry. He discovered magnetic isotope effect, a new remarkable phenomenon of fundamental importance for chemistry, geochemistry, physics and biology. ... He is also the author of the radio induced magnetic isotope effect and spin catalysis. ... A. L. Buchachenko, Chem. ... Chem. ... Magnetic Isotope Effect: Nuclear Spin Control of Chemical Reactions. ... Buchachenko A.L   J.Phys.Chem . ...

Еще в разделе: (Показать все результаты (>625) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 46, No. 4, P. 274 (2005)
• Exciplexes of 9-Cyanophenantrene With Electron Donors. Solvent Effect of
• An in situ 13C MAS NMR study of zeolite catalysed alkylation of polar and

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>15) - storage.bioinf.fbb.msu.ru/ )