Электронная библиотека Попечительского совета . ... Bentz W. - A characterization of T3 separation for a special class of varieties . ... Название: A characterization of T3 separation for a special class of varieties . Автор: Bentz W. Аннотация: . T3 to be valid for the topological algebras of a variety. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8937) - lib.mexmat.ru/ )

• Ozkasap O., Caglar M. - Traffic characterization of transport level reliable
• Kang Li - Ceramic Membranes for Separation and Reaction :: Электронная
• Aida T., Silveston P.L. - Cyclic Separating Reactors :: Электронная библиотека

НОВОСТИ: КОНФЕРЕНЦИИ, КОНГРЕССЫ ПО МЕМБРАНАМ - 2000 . ... Contact: Arab School of Science and Technology (ASST), P.O.Box 7028, Damascus, Syria . Phone: +963 11 5118904 . Fax: +963 11 5111083, E-mail: asst@syriatel.net . ... Practical Membrane Technology Short Course . ... Contact: S.Koseoglu . Phone: +1 409 845 2749, E-mail: s-koseoglu@tamu.edu or C.Vavra . Phone: +1 409 845 2758, E-mail: cjvavra@tamu.edu . ... Phone and Fax: +44 1275 853311, E-mail: confsec@dial.pipex.com . ...

Еще в разделе: (Показать все результаты (>1252) - chem.msu.ru/ )

• [На предыдущий раздел]
• SEPARATION SCIENCE AND TECHNOLOGY
• Host-guest complexation as a tool for solvent extraction and membrane transport

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... в журнале Separation Science and Technology , издательство Marcel Dekker Inc. ... Arkhipova A.A. , Statkus M.A. , Tsysin G.I. , Zolotov Y.A. в журнале Separation Science and Technology , издательство Marcel Dekker Inc. ...

Еще в разделе: (Показать все результаты (>5767) - istina.msu.ru/ )

• Journal of Separation Science - журнал | ИСТИНА - Интеллектуальная Система
• Separation and Purification Technology - журнал | ИСТИНА - Интеллектуальная
• Gotta D. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>1368) - zmmu.msu.ru/ )

• Characters of Soprano Pipistrelle - abstract
• Russian Journal of Theriology

Journal of Membrane Science, 2004, V. 235-236 VOL. 235, NO. ... Journal of Membrane Science 2004, 235 (1-2) 73-86 Ho Bum Park, Chul Ho Jung, Youn Kook Kim, Sang Yong Nam, Sun Yong Lee and Young Moo Lee. ... Journal of Membrane Science 2004, 235 (1-2) 131-138 Youn Kook Kim, Ji Min Lee, Ho Bum Park and Young Moo Lee. ... Journal of Membrane Science 2004, 235 (1-2) 147-155 VOL. ... Journal of Membrane Science 2004, 236 (1-2) 39-51 Dong-Wook Lee, Yoon-Gyu Lee, Bongkuk Sea, Son-Ki Ihm and Kew-Ho Lee. ...

Еще в разделе: (Показать все результаты (>176) - www.chem.msu.ru/ )

• http://www.chem.msu.ru/rus/journals/membranes/26/html/vol245.pdf
• http://www.chem.msu.ru/rus/journals/membranes/24/html/vol237.pdf
• http://www.chem.msu.ru/rus/journals/membranes/26/html/vol243.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>221) - www.genebee.msu.ru/ )

• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee

... Modeling of separated flow in the inlet of a circular suction channel" . ... Methods for the mathematical modeling of separated flows in the inlet of a suction channel are discussed on the basis of the discrete vortex peculiarities of circular and polygonal shapes. ... Keywords: separated flows, discrete vortices, flows near a suction channel . PDF (in Russian) (541KB) . PDF. zip (in Russian) (465KB) . ...

Еще в разделе: (Показать все результаты (>195) - num-meth.srcc.msu.ru/ )

• "Modeling of separated flows near a suction slot"
• "Modeling of separated flows in CFD software FlowVision-HPC"
• "A separating plane algorithm with limited memory for convex nonsmooth

... If encoding_list is omitted, detect_order is used. ... Detect character encoding with current detect_order */ echo mb_detect_encoding($str); /* "auto" is expanded to "ASCII,JIS,UTF-8,EUC-JP,SJIS" */ echo mb_detect_encoding($str, "auto"); /* Specify encoding_list character encoding by comma separated list */ echo mb_detect_encoding($str, "JIS, eucjp-win, sjis-win"); /* Use array to specify encoding_list */ $ary[] = "ASCII"; $ary[] = "JIS"; $ary[] = "EUC-JP"; echo mb_detect_encoding($str, $ary); . ...

Еще в разделе: (Показать все результаты (>833) - oit.cmc.msu.ru/ )

• mb_detect_order
• mb_convert_encoding
• Instruction separation

This section gives a summary of command usage. It enables you to see how options can be given to the command. ... The first word or consecutive characters are the name of the command. ... A ' - ' (hyphen) preceding a character indicates that this is an option that can be applied to the command. Options grouped together after a single hyphen, like this, [-abcD] can be used in this format. If they are given separately, like this, [-n] [-r] [-Z] then they must be used in this format. ...

Еще в разделе: (Показать все результаты (>196) - comet.sai.msu.ru/ )

• Sorting on a specific field
• Changing the field delimiter
• Overview of Character-Level Elements

Next: Stringified Object References Up: Sample Program Previous: MICO application . CORBA would be pretty useless if you always had to run the object implementation ( server ) and the client that uses the server in the same process. Here is how to separate the client and server parts of the example in the previous section into two processes running on the same or on different machines . ... Stringified Object References . ... The MICO Binder (CORBA Extension) . ...

Еще в разделе: (Показать все результаты (>336) - rtm-cs.sinp.msu.ru/ )

• Stringified Object References

Encode character sequences in "string" , by mapping characters (or sequences of characters) to an alternative character (or sequence of characters). ... new="tokenlist" . comma-separated list of replacement tokens. ... Example: %SEARCH{ "%ENCODE{ "string with "quotes"" type="quotes" }%" noheader="on" }% When using old and new , be aware that the results of applying earlier tokens are not processed again using later tokens. ... This topic: System > WebHome > Macros > VarENCODE . ...

Еще в разделе: (Показать все результаты (>5070) - wiki.cmc.msu.ru/ )

• WikiSyntax < System < Foswiki

This diagram shows the effect of the 'separate' value of the 'border-collapse' property. The diagram shows a three column, two row table whose cells are subject to the separated borders model. The cells themselves have a grey background color and an 'inset' border style, which makes them appear to sink into the page. ... The table itself has a 10pt 'outset' border that gives one the impression the table is rising out of the page. ...

Еще в разделе: (Показать все результаты (>1153) - crydee.sai.msu.ru/ )

• Long description of example illustrating rows separated by a border
• Appendix D: The grammar of CSS2
• Boundary layer transition

... Structural modeling of PPI (protein docking) can be roughly divided into: (i) free docking, where sampling of the binding modes is performed regardless of the possible existence of similar experimentally determined structures, and (ii) template-based or comparative docking, where such similar complexes (templates) determine docking predictions. ... 2006) A new measure for functional similarity of gene products based on Gene Ontology, BMC Bioinformatics, 7:302. ...

Еще в разделе: (Показать все результаты (>324) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/131.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/160.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/48.pdf

. [ Войти ] . Главная -> Фильмы -> The Separation . Пользователи . Демо . Деньги . Фильмы . Форум . The Separation . Великобритания 2003 . отметить . Мультфильм . Ужасы . Драма .

Еще в разделе: (Показать все результаты (>52) - kinfo.ru/ )

• Separate Lies - Фильмы - Kinfo.ru
• A Separate Peace - Фильмы - Kinfo.ru
• Separate Vacations - Фильмы - Kinfo.ru

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... Changed: . ... Working in TWiki is as easy as typing in text - exactly like email . ... You can create a forced internal link by enclosing words in double square brackets. Note: Text within the brackets may contain optional spaces; the topic name is formed by capitalizing the initial letter and by removing the spaces; for example, [[text formatting FAQ]] links to topic TextFormattingFAQ . ...

Еще в разделе: (Показать все результаты (>36167) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (1 vs. 4) - TWiki
• %TOPICTITLE% (3 vs. 4) - TWiki
• %TOPICTITLE% (41 vs. 42) - TWiki

... PROJECT 01-0172 . Dynamic processes in amorphous glassy polymers and their effect on gas transport: theoretical, experimental and simulation studies . ... The main goal of this Project is to study a influence of chemical structure of the polymer unit on the gas transport parameters by the methods of the conformational analysis , method Monte Carlo and molecular-dynamic method. ... Theoretical and simulation methods will be used for study of gas transport of glassy polymers . ...

Еще в разделе: (Показать все результаты (>321) - polly.phys.msu.ru/ )

• PSMTLab - Liquid Crystals
• Publications
• Conferences

... The PORT command syntax is: PORT SP host- port CRLF The host- port host- address information is is transmitted argument is and a 16-bit broken into as a decimal the concatenation of TCP port - address . 8-bit fields and the number (in character a 32-bit internet This address value of each field string mentioned how Special thanks Lunt, and Brian the initial for assigning long ... Piscitello [Page 1] RFC 1545 FTP Over Big Address November 1993 representation). ...

Еще в разделе: (Показать все результаты (>15689) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1545.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1153.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc1153.txt.pdf

The revision of the MASS/DIMM star catalogue N. Shatsky, V. Kornilov March 16, 2008 Abstract The compilation of the (updated) version of the MASS (MASS/DIMM) device target catalogue is described. ... Then the list was cleaned according to following criteria: I. Remove stars too faint for a MASS device. ... Here the color equation of the Sternb erg device was taken: M AS S mag = V mag + 0.45 (B - V ); stars with M AS S mag > 3.2 were removed. ... This was made based on the GCVS4.2 catalogue data. ...

Еще в разделе: (Показать все результаты (>16) - curl.sai.msu.ru/ )

Monday test Leaf morphology Leaf anatomy Introduction to Botany. ... Shipunov BIOL 154.10 Monday test Leaf morphology Leaf anatomy Terminal characters Leaves in nature Submerged and floated leaves of Ondinea Shipunov BIOL 154.10 Monday test Leaf morphology Leaf anatomy Terminal characters Leaves in nature Leaf mosaic Distribution of ... Shipunov BIOL 154.10 ...

Еще в разделе: (Показать все результаты (>191) - herba.msu.ru/ )

• Материалы к полевому сезону
• Morphological differences of Nymphaea alba L

... List of solitary restriction endonucleases in complete prokaryotic genomes . List of groups of orthologous R-M systems. List of all analyzed genomes. Contains those orthologous groups that include at least one separated R-M system . R-M orthologous group ID . REs alignments . MTases alignment . Group 1 . ...

Еще в разделе: (Показать все результаты (>4) - mouse.belozersky.msu.ru/ )