PHP Manual . ... PHP 4 >= 4.0.2) ldap_compare -- Compare value of attribute found in entry specified with DN . int ldap_compare ( int link_identifier, string dn, string attribute, string value) . ... Returns -1 on error. ldap_compare() is used to compare value of attribute to value of same attribute in LDAP directory entry specified with dn . The following example demonstrates how to check whether or not given password matches the one defined in DN specified entry. Example 1. ...

Еще в разделе: (Показать все результаты (>505) - oit.cmc.msu.ru/ )

• switch

... TWikiUpgradeGuide . ... Upgrade Requirements . Major Changes Compared to TWiki Release 01-Sep-2004 . ... TWiki-4.0.0 is a major new release. ... To upgrade from a release prior to TWiki Release 01-Sep-2004, start with TWiki:TWiki.UpgradingTWiki on TWiki.org . ... Create a new directory for your new installation: Let's call this distro/ . ... UpgradeTwiki creates the new installation in a new directory tree. ... Follow the installation instructions, and install the new release in a new directory. ...

Еще в разделе: (Показать все результаты (>38000) - dualopt1.cmm.msu.ru/ )

• RegularExpression - TWiki - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki
• %TOPICTITLE% ( vs. 1) - TWiki

filecommander (2.50-alpha18) squeeze; urgency=low * Alpha 18 - Add natural sort option. Add hot keys for configuration dialog fields. - fctar: Fix "Unknown switch" error message. Fix following a renamed file. ... Improve error reporting when there's an error in a boolean expression. Add new %timestamp operator which can be compared against either a literal yyyymmddhhmmss value or the timestamp of another file using @filename syntax. ... Brian Havard Tue, 31 Dec 2013 ...

Еще в разделе: (Показать все результаты (>4208) - crydee.sai.msu.ru/ )

• Tutorial on Fortran 90, Digital UNIX
• Image: Nijo castle, Shogun palace. The main building. Comparing to temples and
• Image: The procedure is as follows: put a coin into special box, pull a cord

... In this program there will be no charts in which to compare starfields or conduct magnitude comparison star photometry. The latter information will hopefully be made available once an event has been sanctioned by the IAU as being a bonifide event. ... NOTE: The Astronomical Society of the Pacific has just come out with a further scaled down version of the Digitized Sky Survey that is currently available (10X version). ...

Еще в разделе: (Показать все результаты (>2465) - www.sai.msu.su/ )

• APOD: 2015 October 24 - Jupiter in 2015
• APOD: October 21, 1999 - Follow The Spots
• SAL- Numerical Analysis - Optimization - HOPDM

... Asymptotic Studies of Solar and Stellar Dynamo Waves . Firstly, we describe main concepts of the mean field dynamo-theory. Then we formulate position of the dynamo wave problem following Parker (1955) ideas. Using analogues between this and quantum mechanics theory we use the semiclassical approach for WKB asymptotic study of traveling dynamo waves. ... In addition, we outline prospects of application of this theory not only for the solar but for stellar dynamos. ...

Еще в разделе: (Показать все результаты (>362) - xray.sai.msu.ru/ )

• Simple Universe

. The following topics are related to your present task. Select an item for more information about it. Comparing directories . Contrasting two text files . Comparing files under SCCS control .

Еще в разделе: (Показать все результаты (>242) - comet.sai.msu.ru/ )

• Examples of using the diff command
• Comparing files under SCCS control
• Comparing directories

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Price Compare . ... a href=http://easyipadlessons67.blinkweb.com>Easy iPad Lessons</a> . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>5266) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: compare administrative billion
• Экологический Форум - Фундаментальная Экология: Compare Shopping
• Экологический Форум - Фундаментальная Экология: Compare Prices

О лаборатории . ... Лаборатория теоретической биофизики . ... Here orig1 is the starting value of internal coordinate and zero corresponds to this value in current geometry. disp1 means step of scanning (degrees for angles and Angstroms for bonds). ndisp1 points number of steps in PES scan. vect1 ? ... Нет комментариев " Scanning PES ab initio and in MM " . ... OPLS-AA patch for different types of molecules . ... Scanning PES ab initio and in MM . ... 2015 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>33) - erg.biophys.msu.ru/ )

... Jupiter in 2015 . ... 24.10.2015 . ... Credit Copyright: NASA, ESA , Amy Simon (GSFC), Michael Wong (UC Berkeley), Glenn Orton (JPL-Caltech) Explanation: Two remarkable global maps of Jupiter's banded cloud tops can be compared by just sliding your cursor over this sharp projection (or follow this link) of image data from the Hubble Space Telescope. ... In fact, the Great Red Spot, the famous long-lived swirling storm boasting 300 mile per hour winds, is seen sporting a rotating, twisting filament. ...

Еще в разделе: (Показать все результаты (>6895) - www.astronet.ru/ )

• Sun vs Super Moon
• La Palma Eclipse Sequence
• Journal "Peremennye Zvezdy"

... Building Packages for Multiple Architectures and Operating Systems . ... This is done by matching information from the build system's uname output against a number of rpmrc file entries. ... Specifically, these entries are used to create a table that maps information from uname to the appropriate architecture/operating system name. ... The --buildarch and --buildos options can be used to set the build-time architecture and operating system rather than relying on RPM's automatic detection...

Еще в разделе: (Показать все результаты (>451) - uneex.lorien.cs.msu.su/ )

• mod_ldap - Apache HTTP Server
• Relevant Standards - Apache HTTP Server

... Linux installation & system administration . ... There are a myriad of mailing lists that may prove helpful in providing answers to your questions as well. These can usually be found through a simple web search (for example, searching for ``linux raid mailing list'' might help you find mailing lists devoted to RAID issues under Linux). ... Description of available Red Hat lists: http://www.redhat.com/ . ... Description of available GNOME lists: http://www.gnome.org/mailing-lists/index.shtml . ...

Еще в разделе: (Показать все результаты (>416) - itpm.msu.su/ )

• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL
• MySQL Reference Manual for version 3.23.10-alpha. - 21 How MySQL compares to
• Outlook on the Following Chapters

Электронная библиотека Попечительского совета . ... Lord R.G., Brown D.J. - Leadership Processes and Follower Self-identity . ... Название: Leadership Processes and Follower Self-identity . Авторы: Lord R.G., Brown D.J. Аннотация: . ... In this book, an attempt is made to develop such a theory, maintaining that the central construct in this process is the self-identity of followers. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>14917) - lib.mexmat.ru/ )

• Lewis M. - Comparing, Designing, and Deploying VPHs :: Электронная библиотека
• Sklar D. - Learning PHP 5 :: Электронная библиотека попечительского совета
• Поиск книг, содержащих Производная конвективная (derivative following the

... Investigations in the field of higher fullerenes . Abstract Halogenation of higher fullerene mixtures or their perfluoroalkylation with R F I followed by HPLC separation of R F derivatives and subsequent synchrotron X-ray crystallographic study allowed one to confirm cage connectivities of higher fullerenes and, in addition, to receive information concerning their reactivity in radical addition reactions. ... Moscow University Chemistry Bulletin . 2009, Vol. ... Copyright (C) Chemistry Dept., ...

Еще в разделе: (Показать все результаты (>821) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• LABORATORY OF PHOTOCHEMISTRY
• Moscow University Chemistry Bulletin Vol. 49, No. 2, P. 122 (2008)

... Constants . Meaning of MPI s defined constants Note that the Fortran types should only be used in Fortran programs, and the C types should only be used in C programs. For example, it is in error to use MPI_INT for a Fortran INTEGER. Datatypes are of type MPI_Datatype in C and of tyep INTEGER in Fortran. ... INTEGER . ... return the maximum . ... Any error return . ... Error handler that returns error codes (as value of MPI routine in C and through last argument in Fortran) . ... Центры . ...

Еще в разделе: (Показать все результаты (>401) - www.parallel.ru/ )

• MPI_Comm_compare | PARALLEL.RU - Информационно-аналитический центр по
• MPI_Group_compare | PARALLEL.RU - Информационно-аналитический центр по
• Semantics | PARALLEL.RU - Информационно-аналитический центр по параллельным

Compares two revisions of a document. ... Templates . ... The CompareRevisionsAddOn compares two revisions of a document, like rdiff does. But in contrast to normal rdiff , the comparison is done with the rendered HTML output of the revisions instead of the Foswiki source text files. ... Screenshot of interwoven output: . ... See section Templates below . ... In the templates for a section, %TEXT1% is replaced by the text of the old revision and %TEXT2% is replaced by the text of the new revision. ...

Еще в разделе: (Показать все результаты (>1955) - wiki.cs.msu.ru/ )

• HistoryPlugin < System < Foswiki
• SafeWikiPlugin < System < Foswiki
• IfStatements < System < Foswiki

... Templates . ... The number n of unchanged sections which should be shown around changed sections. ... See section Templates below . ... The templates themselves are broken into 7 parts: template for start of page %REPEAT% template for unchanged section which is not printed according to context %REPEAT% template for unchanged section which is printed %REPEAT% template for changed section %REPEAT% template for added section %REPEAT% template for deleted section %REPEAT% template for end of page . ...

Еще в разделе: (Показать все результаты (>6001) - wiki.cmc.msu.ru/ )

• HistoryPlugin < System < Foswiki

... The goal of our work was to study the particularities of the flower behavior of Nymphaea candida L. To reach this goal we marked these problems: . 1)To study the dynamics of the behavior of Nymphaea candida flowers. 2)To find the factors which cause the rhythmic behavior of the flowers and intensity of the bloom of Nymphaea candida . ... 4)To compare published material on biological rhythms of different plant species with our material on the behavior of Nymphaea candida flowers. ...

Еще в разделе: (Показать все результаты (>150) - herba.msu.ru/ )

• The employment of quantitative methods for the lake ecosystem research
• Instruction to authors

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>186) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services
• Fasta3 help

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>118) - www.prof.msu.ru/ )

IEN 180 Danny Cohen USC / ISI March 1981 A suggestion for internet message forwarding for MOSIS ------------------------------------------------------ Messages are forwarded across (between) networks by Message Forwarding Programs (MFP) which live on hosts with access to more than one network. Note that in this discussion the term NETWORK means a message system. ... The operation of the scheme is based on the following two fields: - FSR: Forward-Source-Route, and - RSR: Return-Source-Route. ...

Еще в разделе: (Показать все результаты (>18581) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc490.txt.pdf
• Index of /pub/gentoo-portage/dev-ml/ppx_compare/
• Index of /pub/gentoo-portage/dev-perl/Struct-Compare/