The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>53) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index . To move the sample on the Z-axis fast (it may need in the end of the work, for example) use SPM/ Move sample menu command. This command allow to move the sample up (to the probe) or down (from the probe) at specified value. Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index Filonov 2005-02-04

Еще в разделе: (Показать все результаты (>101) - www.spm.genebee.msu.ru/ )

... fc3:dokuwiki:example ]] . THEP . ... Note: The Dokuwiki to be upgraded is in /var/www/wiki on the machine called mybox, I am logged in as root, and Dokuwiki version 2005-07-01 has been extracted to ~/dokuwiki/wiki/ . ... Create a temp directory mybox:/var/www# mkdir newwiki . ... Copy the changes.log file to the new location mybox:/var/www/newwiki# cp .. / wiki / changes.log data / . Copy standard data to the new location mybox:/var/www/newwiki# cp -R .. / wiki / data /* data / pages / . ...

Еще в разделе: (Показать все результаты (>1066) - theory.sinp.msu.ru/ )

• Examples
• Example: Summation of diagrams and symbolic integration by means of the Reduce

grdedit - Modifying the header in a 2-D grdfile grdedit grdfile [ -A ] [ -D xunit / yunit / zunit / scale / offset / title / remark ] [ -R west / east / south / north [ r ] ] [ -S ] grdedit reads the header information in a binary 2-D grdfile and replaces the information with values provided on the command line [if any]. ... Older gridfiles (i.e., created prior to GMT 3.1) often had excessive slop in x _ inc , y _ inc and an adjustment is necessary. Newer files are created correctly. ...

Еще в разделе: (Показать все результаты (>309) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~polar/html/black_hole_coll/kharkov_zaja
• http://xray.sai.msu.ru/~ivan/gmt/man/psrose.html
• http://xray.sai.msu.ru/~ivan/gmt/example03.html

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>18) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Preface to Research Project "High-Level Decision Making in the Soviet Administrative-Command Economy", . ... This introductory article summarizes the High-Level Soviet Decision Making Project of which the Lazarev and Belova papers are examples. It explains that social scientists must use the modern methods of information economics and the New Economic History to study the Soviet state and party archives using methods of interests to economists and political scientists in general. ...

Еще в разделе: (Показать все результаты (>48) - hist.msu.ru/ )

• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples
• Economic History. Yearbook. 2001

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>133) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• Input Formats

Myotis . Uropatagium venation pattern in bats as diagnostic character (by the example of genus Myotis ) . ... By the example of genus Myotis it was shown that venation pattern on uropatagium of bats in some cases can be used as diagnostic character. Venation features on uropatagium allow easy to separate Daubentonв?Ts bat, eastern water bat, big-footed bat, and pond bat from Brandtв?Ts bat, Siberian bat, whiskered bat, and Ikonnikovв?Ts bat. ... Bats]. ... Bats of the Russian Far East]. ...

Еще в разделе: (Показать все результаты (>403) - zmmu.msu.ru/ )

Russian TeX Disk . ... Please, use "Save link as" (right mouse button) for downloading files, otherwise binary files will be corrupted. What is russian TeX disk . ... Some TeX versions and tools are installed/russified and can be started directly from CD; other are only distributives plus additional files for their russification. ... FPTEX . ... Directory russian.add: Generic files (mf-sources, pfb-fonts and hyphen file) for russification of any-TeX-realizations in: . ... file readme: . ...

Еще в разделе: (Показать все результаты (>5) - tex.bog.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Outlook и HELO command . ... Outlook "HELO/EHLO"-Bug . ... Outlook doesn't care, it just always send's the computers nickname. ... Re: Outlook и HELO command [ re: alpha ] . ...

Еще в разделе: (Показать все результаты (>1057) - www.fds-net.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Outlook и HELO command . ... Outlook "HELO/EHLO"-Bug . ... Outlook doesn't care, it just always send's the computers nickname. ... Re: Outlook и HELO command [ re: alpha ] . ...

Еще в разделе: (Показать все результаты (>589) - www.snto-msu.net/ )

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: center China. the example, the but to lik . ... a href=http://celinebagsby.zohosites.com/><b>Celine bags</b></a> I think we have too many things. ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>1502) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.
• Экологический Форум - Фундаментальная Экология: on the will example, refine
• Экологический Форум - Фундаментальная Экология: shall year June best example,

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>61) - monkey.belozersky.msu.ru/ )

• SDP home page
• SCOP famyli:
• SCOP famyli: DNA-binding protein LAG-1 (CSL)

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>153) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Entrance Examinations - Main Round

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>14) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters
• CDFE => Online Services => NSR Search Engine
• CDFE provides the major photonuclear databases. Online Services.

Примеры из книги О.Д.Авраамовой . ... 5_2.WRL Повторное использование объектов (лучше смотреть с отмеченной опцией "wireframe rendering" браузера, поскольку сфера находится внутри куба и обычным образом видна не будет) . 6_1.WRL Эллипсоид вращения (пример использования узла Transform) . ... 8_2.WRL Пример иллюстрирует использование вариабельности разных полей узла Material. ... Для того, чтобы пример работал и на вашем локальном диске, не забудьте скопировать файл 12_3.WRL . ...

38. Студенческий форум Физфака МГУ > Каррент мьюзик

39. Removing of blocking effect from video | Graphics and Media Lab

40. http://adept.srcc.msu.ru/adept/java/applet_book/text/text2text1.htm