... All contacts alignment . ... Blue background means a contact with backbone phosphate. ... HBond with major groove + contact through a molecule of water with backbone phosphate; . ... contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + engagement in hydrophobic cluster + contact through a molecule of water with backbone phosphate; ...

Еще в разделе: (Показать все результаты (>238) - monkey.belozersky.msu.ru/ )

• CluD output: 1a1l.pdb1
• Inquiry information || Formats of alignments
• SVETKA, a program for multiple sequence alignments analysus

TOPIC% %JQPLUGINS{"slimbox" format=" Homepage: $homepage <br /> Author(s): $author <br /> Version: $version " }% %STARTSECTION{"summary"}% Show images in a lightbox. Slimbox 2 is a 4 KB visual clone of the popular Lightbox 2 script by Lokesh Dhakar, written using the jQuery javascript library. ... Set IMAGESIZE = 150 --> %IMAGE{"IMG_1190.JPG"}% %IMAGE{"IMG_1190.JPG"}% %IMAGE{"IMG_1190.JPG"}% </div> . This topic: System > JQueryPlugin > JQuerySlimbox . ... Copyright by the contributing authors. ...

Еще в разделе: (Показать все результаты (>1229) - wiki.cs.msu.ru/ )

Testing the hypothesis on the 'drift' of parameters in the moving average model / I. G. Erlikh. Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. 2009. ... Test statistics for checking the conformity of the moving average model to observations are constructed. The statistics are based on sequential processes constructed using residuals and compatible with the equation for estimation of the unknown parameter of the model postulated. ...

Еще в разделе: (Показать все результаты (>2) - vestnik.math.msu.su/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Anonymous . ... Re: Heroes III now! [ re: Aleksandr ] . ... Рейтинг: -410 . Re: Heroes III now! [ re: Anonymous ] . ... Рейтинг: 5 . ... Re: Heroes III now! [ re: angor ] . ...

Еще в разделе: (Показать все результаты (>221) - www.snto-msu.net/ )

• Персональная информация о Zyxci - Public forum of MSU united student networks
• ХИМИКИ!!! ВСЕМ СЮДА !!!! - Public forum of MSU united student networks
• hmm 3.5 компании WOG - Public forum of MSU united student networks

... Sergey : Re: Заболванил Нерой аудио диск... [re:Domain] 07.03.2003 23:09 | ... Я вот думаю, может Нера в каком-то формате это все записала, отличном от Audio CD? ... а сам сидюк (в компе я имею в виду), чтоо говорит о твоем диске? он распознает его, как музыкальный? ... А что нибудь особенное надо делать, чтобы записать 800метровый Cd А то друг принес болванку а неро вроде в инфе выдала капасити 700 с небольшим хреном . ... там есть опция overburn, ставишь емкость диска в минутах сколько тебе нужно ...

Еще в разделе: (Показать все результаты (>397) - www.fds-net.ru/ )

• Heroes III now! - Public forum of MSU united student networks
• Ж Е L E Z О н а - Public forum of MSU united student networks
• Велики сравните, плиз! - Public forum of MSU united student networks

... COMPUTER CENTER . ... T he scientific and teaching computer center of the Philological Faculty was founded in 1990. At that time, the entire faculty used three 8086XT personal computers and a "powerful" DEC compatible computer MERA-CAMAC (256 Kb RAM with 10 Mb HDD!) which could handle eight remote terminals. ... In 1995, faculty computers were networked. ... Motto of the Computer Center . ... Teach computer science to undergraduates and post-graduates. ... Head of Computer Center . ... tel. ...

Еще в разделе: (Показать все результаты (>41) - www.philol.msu.ru/ )

... Res2dInv software ( Geotomo Inc. ... Terrametr SAS4000/SAS1000 equipment ( ABEM Instrument AB ) . ... IPI2win software ( Moscow State University ) X2IPI allows to perform 5 main tasks with data of multielectrode measuruments: . To prepare and to modify protocols files [*.seq or *.org] files needed for multielectrode measurements with SYSCAL or SAS4000/SAS1000 equipments . ... To work with field data files from SYSCAL or SAS4000/SAS1000 equipments and in Res2dInv format: . ... merge data files, . ...

Еще в разделе: (Показать все результаты (>5) - geophys.geol.msu.ru/ )

Sokoloff D., Zhang H., Moss D., Kleeorin N., Kuzanyan K., Rogachevski I., Gao Yu, Xu H., Current helicity constraints in solar dynamo models, arXiv:1212.1643, 2012. We investigate to what extent the current helicity distribution observed in solar active regions is compatible with solar dynamo models. ... For comparison, we also studied a more basic 2D mean-field dynamo model with simple algebraic alpha quenching only. ...

Еще в разделе: (Показать все результаты (>17) - srcc.msu.ru/ )

Home :: Personnel :: Govorun, Elena Nikolaevna :: List of Publications . ... Kudryavtsev, E. Govorun, A. Litmanovich . ... I. Erukhimovich, E.N. Govorun, A.D. Litmanovich . ... E.N. Govorun, A.D. Litmanovich . ... N.A. Plate, A.D. Litmanovich, Ya.V. Kudryavtsev, E.N. Govorun . ... Y.V. Kudryavtsev, E.N. Govorun, A.D. Litmanovich, H.R. Fischer . ... A.D. Litmanovich, N.A. Plate, Ya.V. Kudryavtsev, E.N. Govorun . ... A.V. Chertovich, D.V. Guseva, E.N. Govorun, Ya.V. Kudryavtsev, A.D. Litmanovich . ...

Еще в разделе: (Показать все результаты (>15) - polly.phys.msu.ru/ )

• List of full papers

... help . find changesets by author, revision, files, or words in the commit message Diff Formats Mercurial's default format for showing changes between two versions of a file is compatible with the unified format of GNU diff, which can be used by GNU patch and many other standard tools. ... To make Mercurial produce the git extended diff format, use the --git option available for many commands, or set 'git = True' in the [diff] section of your configuration file. ...

Еще в разделе: (Показать все результаты (>1636) - kodomo.cmm.msu.ru/ )

• Global and Local Alignment of A.A Sequences
• Multiple alignment
• Task 4 (alignment)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>15) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>69) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/137.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf