It could be that SETI signals have arrived at the Earth, but are lower then the noise level, and our receivers cannot detect them. ... Fig. ... It follows that two zones form around the star with civilization X: "Zone Yes", where its SETI signal can be detected, and "Zone No", where its signals are hidden by noise (Fig. ... In practice, it is more efficient to use a time factor, since the problem of SETI contact does not limit the duration of the signal element and semantic text. ...

Еще в разделе: (Показать все результаты (>180) - lnfm1.sai.msu.ru/ )

• Anna Mel'nik - Description of the catalog
• Jupiter Outer Satellite Orbit Ephemerides.
• Data bases of Natural Satellites. Documentation. Sources

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD, scientist Marina E. Tamm . ... Broad-scoped inorganic chemist. ... Seminars and practical work on inorganic chemistry for first-year students . ... Neudachina V.S., Shatalova T.B., Shtanov V.I., Yashina L.V., Zyubina T.S., Tamm M.E., Kobeleva S.P. Surface Science 2005, v. 584, iss. 1, p. 77-82. ... 2008-2010 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>19) - www.lssm.inorg.chem.msu.ru/ )

• Лаборатория химии и физики полупроводниковых и сенсорных материалов | Проекты
• The Laboratory of chemistry and physics of sensor and semiconductor materials

. Diameter of circular antenna . 576 m . Number of antenna elements . 895 . Size of an element . 11.4 x 2 m . Geometrical area . up to 20000 sq.m . Wavelength range . 1 - 50 cm . Angular resolution . 2 - 400 arcsec . Accuracy of coordinate determination . better than 1 arcsec . Limiting sensitivity (1994): . flux density . 0.500 mJy . brightness temperature . 0.050 mK

Еще в разделе: (Показать все результаты (>7) - www.issp.ac.ru/ )

• Comet Ephemerides

... Novel Silica Based Sorbents with Polymeric Anion Exchange Layer for Ion Chromatography : .. ... On-line Solid-Phase Extraction ­ Liquid Chromatography Determination of Phthalates and Phenols Based on Extraction on Carbon Sorbent and Desorption by Subcritical Water : , .. ... C Spectrophotometric Determination of Catecholamines Using Gold Nanoparticles. ... Determination of Methylphosphonic Acid in Soils by Reactive High - Performance Liquid Chromatography - Tandem Mass Spectrometry : .. ...

Еще в разделе: (Показать все результаты (>21) - analyt.chem.msu.ru/ )

... Abstracts . ... Accomodation . ... Experiments and models. The connection between them is the reflection of model characteristics on the class of measurable quantities: positions of spectral bands and lines. ... Models ambiguity. ... Modern design methods (modern methods of calculation). Quantum beatings. abstract (PDF) . 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>25) - www.msm.biophys.msu.ru/ )

Some additional inquiry information . ... WPGMA . As any cluster method , UPGMA (unweighted pair-group method of analysis) performs the structure of a set of some homogeneous elements ( in our case alignment is a set of amino acid sequences ). ... Firstly, when we calculate correlations between distance matrices on the whole alignment and on separate position (for selecting "diagnostic" positions) - we should be sure that these data are not distorted by multiple repeating of one sequence. ...

Еще в разделе: (Показать все результаты (>893) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SDP home page
• SCOP famyli:

... This is so elementary it hardly needs comment . ... Единица (меньше единицы по модулю) . ... Group unit element . ... Единичная геометрическая краткость . ... Unit normal . ... Let $v$ be a vector of unit length . Единичный вектор внешней нормали . Unit outer normal vector . Outer normal unit vector . Единичный вектор восходящей нормали . ... Единичный вектор касательной . ... Единичный вектор направления движения . ... Normal unit vector . Unit normal vector . ... One component . ...

Еще в разделе: (Показать все результаты (>37) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/26.htm

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>20) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• LCore

What would you like to search for? ... Case sensitive Match whole word Recent publications first . ... What to do if you are looking for ... words iron and oxide in the same record: iron and oxide . both these words or chemical formulae: (iron and oxide) or Fe2O3 . ... That's why do not use Co instead of cobalt : you will find Co even in al co hol! ... The hidden part of the database allows you to use full names of chemical elements instead of the short ones (like nickel instead of Ni ). ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

... Поступление в лабораторию . ... Электронный журнал "Компьютерная графика и мультимедиа" . ... GrowCut is a SHAREWARE image segmentation plugin, designed for Photoshop-compatible image editors (that support .8bf plug-ins). ... This plugin uses a simple paintbrush interface to solve difficult image cutout tasks. ... Filter plugin returns a correct cutout (instead of black-and-white mask, as in previous versions) . ... Added a new plugin - GrowCut Extract with different interface . ...

Еще в разделе: (Показать все результаты (>257) - graphics.cs.msu.ru/ )

• Growcut | Graphics and Media Lab
• Image-based 3D reconstruction of urban scenes | Graphics and Media Lab
• GML LidarK Library | Graphics and Media Lab

... education . research . ... Fundamentals of Nanotechnology . ... Molecular physiology . ... Pass/fall exam: 5 p.m., 22 May, 2009 (those third-year students who pass the exam undertake further study majoring in Nanosystems and Nanodevices , Functional Nanomaterials , Nanobiomaterials and Nanobiotechnology). ... 10 February 2009 . ... Prof. Yu. ... Work of molecular motors: ATP synthetase, photosynthetic reaction centers, retinal containing photosensitive proteins (rhodopsin, bacteriorhodopsin.) ...

Еще в разделе: (Показать все результаты (>10) - nano.msu.ru/ )

• Fundamentals of Nanotechnology, 2009 | Научно-образовательный центр по

Diploma thesis abstract Kostylev Andrey Yurievich Spatial field distribution laser beam control by means of electrically driven phase elements In this work we present results of experimental formation of beams with vortex wave front dislocation by means of phase optical elements: spiral phase plate, bimorph adaptive mirror, controlled liquid crystal modulator. ... Gerchberg-Saxton algorithm has been implemented to determine required liquid crystal modulator phase. ...

Еще в разделе: (Показать все результаты (>26) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2006/Konjashkin_Olenin_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Bulushova_Romanovsky_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2011/Mukhin_Shkurinov_en.pdf

Lomonosov Moscow State University, Faculty of Mechanics and Mathematics, English Department Six standard deviations suffice by Y. Demidovich, group 305, English teacher: A. A. Savchenko 1. ... The proof of the main theorem is based on the probabilistic method, Paul Erds being regarded as its inventor. ... It is important to prove that the main theorem is "best possible" up to the constant factor, i.e. to show that the best asymptotic is obtained. ... English teacher: _______________/ A. Savchenko ...

Еще в разделе: (Показать все результаты (>18) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/section2.pdf
• http://www.eng.math.msu.su/download/section_1.pdf
• http://www.eng.math.msu.su/download/section4.pdf

Warning: scandir(./db): failed to open dir: No such file or directory in /home/swx/public_html/models/database/modules/db.php on line 2 Warning: scandir(): (errno 2): No such file or directory in /home/swx/public_html/models/database/modules/db.php on line 2 . This database contains Solar Energetic Particles(SEP) fluences, measured from august 1997 till 2006 with the instruments on the satellites GOES and ACE. ...

Еще в разделе: (Показать все результаты (>4) - swx.sinp.msu.ru/ )

• http://swx.sinp.msu.ru/models/database/modules/db2.php
• http://swx.sinp.msu.ru/models/database/modules/smdc-db.php

... Historical and ecological determinants in tooth integration of extant and fossil Carnivores (Feliformia) - Cranial biomechanics of Arctic fox (Vulpes lagopus ) using finite element modelling: comparison between mainland and island populations - Phylogeography of the midday jird Meriones meridianus (Rodentia: Muridae) complex: morphological and genetic variation EDUCATION 2009 Ph.D.: «Structure of ... Department of Vertebrate Zoology, Faculty of Biology, MSU, RF. ... 2010, May-Sept. ...

Еще в разделе: (Показать все результаты (>747) - zmmu.msu.ru/ )

• Uropatagium venation pattern in bats as diagnostic character (by the example of
• Mammuthus intermedius (Proboscidea, Elephantidae) from the late Middle

... The purpose of individualized education is to ensure that every student gains access to knowledge, skills and information that will prepare him/her to contribute to variety of communities and workplaces. ... In the USA there are some Schools of Individualized Study. ... That?s why we can describe the individualized study as the basis for introduction to the students? opportunities for self-discovery, diversity and flexibity of the curriculum, creativity and academic exellence. ...

Еще в разделе: (Показать все результаты (>60) - www.prof.msu.ru/ )

• Welche Rolle spielen internationale Erfahrungen bei der Entwicklung einer
• HUMAN RIGHTS AND DEVELOPMENT

... Publications . ... SPDC Laboratory . ... I. Bogdanov and G. Brida and I. D. Bukeev and M. Genovese and K. S. Kravtsov and S. P. Kulik and E. V. Moreva and A. A. Soloviev and A. P. Shurupov}, title = {Statistical estimation of the quality of quantum-tomography protocols}, journal = {Phys. Rev. A}, volume = {84}, number = {4}, pages = {042108}, year = {2011}, doi = {10.1103/PhysRevA.84.042108}, url = {http://link.aps.org/doi/10.1103/PhysRevA.84.042108}, } . ... Download paper: doi page . ...

Еще в разделе: (Показать все результаты (>127) - qi.phys.msu.ru/ )

• Study :: Quantum Information Laboratory
• People :: Quantum Information Laboratory
• Login :: Quantum Information Laboratory

Irina IVANOVA Transformation of the Southeast Asian social and economic space in the process of integration of the region into the global information economy Introduction. ... Common problems are superconcentration of economic activity in overpopulated centers, poor transport access to peripheries and lack of national and global connectivity. ... The nodes of the spatial framework of the Malacca Strait economic region have hierarchical structure as global, regional, national centers (pic.6). ...

Еще в разделе: (Показать все результаты (>179) - www.geogr.msu.ru/ )

• ФОТОКОНКУРС 'ОБЪЕКТИВНАЯ ГЕОГРАФИЯ 2011'. ИТОГИ
• CONTENTS ? 1 - 2012
• Тематика и география зимних экспедиций НСО кафедры в 2002-2009 гг.

... All Morphological filters are based on two operations -- dilation and erosion . ... It is common to call in the above expressions as an image, and as a structural element. The surface plays the role of the image in the morphological filters used in FemtoScan program (lets define it as ), while the object (shown below) most often plays the role of structural element. ... Filter . ... The filter fulfill the operation erosion over the current image using a selected tip as a structural element. ...

Еще в разделе: (Показать все результаты (>28) - www.spm.genebee.msu.ru/ )

• Reconstruction of 3D Images

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>8) - lhe.sinp.msu.ru/ )