... Motivations and Problems of Studying Time . ... Deepening of special scientific concepts . ... Measuring the age of natural systems . ... About relative concept of time . ... Problems of the typological concept of time . ... Biological Time, its Organization, Hierarchy and Presentation by Complex Values . ... Mathematical Temporal Constructions . ... Earth Sciences . ... Time As Variability of Natural Systems: Ways of Quantitative Description of Changes and Creation of Changes by Substantial Flows ....

Еще в разделе: (Показать все результаты (>371) - chronos.msu.ru/ )

• A. P. LEVICH, A. V. SOLOV’YOV. CATEGORY-FUNCTOR MODELLING OF NATURAL SYSTEMS
• MATHEMATICAL BIOLOGY

Search for simple and composite auxin responsive elements in Arabidopsis thaliana genome. ... AR Fs bind in target promoters to the specific sites called AuxRE s (Auxin Response Elements) with the TGTCN N (most frequently TGTCTC) consensus core sequence. ... To test which model predicts AuxREs associated with auxin response better , we performed meta-analysis of publicly available 23 microarray experiments with auxin treatments (Mironova et al., ...

Еще в разделе: (Показать все результаты (>155) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/225.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/134.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/165.pdf

MATSYM - symbolic matrix processor . ... To use the program you will need a MAT file (liked CIR file: "User manual for CIRSYM program") of your system. ... In first string of MAT file enter any text you want to be the title of your system. ... Starting from string 2 (if is not comments - "*") enter the system element name, incident row and column and, optionally, its value. ... To generate a solution, run MATSYM.exe and enter "system_file_name.CIR" or click on the "ENTER" (in "MAT" case). ...

Еще в разделе: (Показать все результаты (>10) - astrometric.sai.msu.ru/ )

CDFE => Online Services => NSR Search Engine Description . This program lets to find articles from Nuclear Science References (NSR). I. Names and descriptions of NSR Search Engine fields . ... Quantity Type Parameter type of <SELECTRS>. ... Target nucleus Chemical symbol or charge and atomic number of target nucleus. ... Range of energy Range of reaction energy (Example: 0.3 - 1 GeV ). ... Example: 1998) . ... Work scheme NSR Search Engine. ... NSR Search Engine printscreen for example. ...

Еще в разделе: (Показать все результаты (>24) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Relational ENSDF
• CDFE => Online Services => Calculator and Graph Engine for Atomic Nuclei

.

Еще в разделе: (Показать все результаты (>2) - lab110.imec.msu.ru/ )

Prospects of Matrix Elements Integration with Markov Chain Monte Carlo Lev Dudko1 1 Andrey Popov 2 SINP MSU 2 aa.p opov@www-hep.sinp.msu.ru, SINP MSU QFTHEP 2010, Golitsyno, Moscow, Russia, 14.09.2010 Lev Dudko, Andrey Popov SINP MSU aa.popov@www-hep.sinp.msu.ru, SINP MSU Prospects of Matrix Elements Integration with Markov Chain Monte Carlo Outline The traditional approach to integrate the squared matrix element and some of its difficulties. What is Markov chain Monte Carlo? ...

Еще в разделе: (Показать все результаты (>118) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2015/1435258273_Krutov_Polezhaev_Troitsky2_2015.pdf
• http://qfthep.sinp.msu.ru/talks2011/anomalous_wtb_qfthep11.pdf
• http://qfthep.sinp.msu.ru/talks2015/1435513529_malyshev_Higgs.pdf

... Class . ... PREV CLASS NEXT CLASS . FRAMES NO FRAMES . ... FIELD | CONSTR | METHOD . DETAIL: FIELD | ... public interface AttributeIterator . ... Use the Iterator methods to fetch elements sequentially. ... Method Summary . ... Returns true if there are more elements. ... next () . Returns the next element. ... Returns true if there are more elements. public Attribute next () . ... Calls to this method will step through successive elements. ...

Еще в разделе: (Показать все результаты (>43) - angel.cs.msu.su/ )

• : Interface DimensionIterator
• : Interface ProtoVariableIterator
• : Interface VariableIterator

MATHEMATICAL MODEL OF CLASSIFICATION OF OBJECTS OF PRODUCTION Sosenushkin E.N. Federal public budgetary educational institution fhighereducationMoscow state technological ... 127055, Moscow, Vadkovsky Lane, 3, 8(916)352-15-14, E-mail: sen@stankin.ru In conditions of the automated low-volume production of details of mechanical engineering , it is appropriate to use the ... To solve those problems, it is appropriate to use the image discrimination theory mathematical apparatus [1]. ...

Еще в разделе: (Показать все результаты (>167) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc21728/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc97718/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc15810/doc.pdf

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>18) - comphep.sinp.msu.ru/ )

• overview [CompHEP]

M obile A stronomical Sy stem of TE lescope- R obots MASTER-II Kislovodsk Lomonosov Moscow State University, Sternberg Astronomical Institute , Moscow Union "Optic" , Kislovodsk Solar Station Latitude = 43 o љ44'.767љN; Longitude = 42 o љ31'.417љE; Altitude = 2067љm MASTERљIIљ(8љsquareљdegress) + MASTERљVWF(VeryљWideљFieldљCameras (FOV=800 square degrees, Timeљresolutionљupљtoљ150љms, with unfiltered m_lim=14m on 5 sec. exposure, and ~10.5m with 0.15 sec) . ... 11h 38m 38.0s , -09d 59m 59s) . ...

Еще в разделе: (Показать все результаты (>2) - apollo.sai.msu.ru/ )

• Meteo :: Kislovodsk Database ::

... The national strategic management system in Russian power industry is far from perfect and is in the process of its formation after a long period of radical reform in the industry. ... This article s goal is to offer a more adaptable conceptual model for national strategic management in a branch of economy (on the example of the electric power industry). ... National strategic management, power industry, conceptual model, level of environmental uncertainty. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>114) - ee-journal.spa.msu.ru/ )

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>5) - npidb.belozersky.msu.ru/ )

Chalkina N.A. Inertial Manifold for a Hyperbolic Equation with Dissipation . ... Sheipak I.A. Spectrum of a Jacobi Matrix with Exponentially Growing Matrix Elements . Sergeev I.N. Oscillation and Wandering of Solutions to a Second Order Differential Equation . Bednov B.B. Steiner Points in the Space of Continuous Functions . ... Kombarov Yu.A. The Minimal Circuits for Linear Boolean Functions . ... Kolyada S.S. Unit Checking Output Tests under Constant Faults for Functional Elements . ...

Еще в разделе: (Показать все результаты (>139) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

arXiv:submit/0064778 [math.AT] 24 Jun 2010 Transitive Lie algebroids - categorical point of view A.S.Mishchenko Moscow State University Intro duction Transitive Lie algebroids have specific properties that allow to lo ok at the transitive Lie algebroid as an element of the ob ject of a homotopy functor. Roughly speaking each transitive Lie algebroids can be described as a vector bundle over the tangent bundle of the manifold which is endowed with additional structures. ...

Еще в разделе: (Показать все результаты (>213) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/1967/MathematicalNotes/Spectral%20sequences%20of%20Adams%20type.pdf
• Publications (English)
• Publications (Russian)

Distributed systems as pattern formation models: space-time behavior investigation and elements of dynamics control". ... A new method of local dynamics analysis of coupled map lattices (CML) was proposed. ... New effects of global behavior of CML was found. Maps can represent some systems. ... And the points represent state of the system, which was determined by Rybalko method (Lambda values; color = period = order, black = zero period = chaos) and the period of cycle (P values). ...

Еще в разделе: (Показать все результаты (>61) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/Galss_ceramics.pdf

... Faculty of Physics . M.V.Lomonosov Moscow State University . 7 (495) 939-16-82 info@physics.msu.ru . ... Contacts . ... Education . ... Dr. Michael Tribelsky (Faculty of Physics, Lomonosov Moscow State Univ.) in cooperation with his colleagues from the Institut Fresnel (France) and the Univ. of Cantabria (Spain) discovered a possibility of using dielectric spheres with a high refractive index as multifunctional elements of optical devices. ... 7 495 939-16-82, . ... Faculty of Physics, 2016 . ...

Еще в разделе: (Показать все результаты (>54) - phys.msu.ru/ )

• Гумбольдтовская лекция на физфаке

VES visualization as the dependence Rho a =f ( r ) is suitable for analysis of only HLS . ... For that the special visualization program IPI-2D was developed, which helps to draw VES data in many forms. a) Rho a cross-sections for AMN & MNB pole-dipole arrays give the first representation of structure under investigation, its inhomogeneity and NSI influence (see fig.7 ). b) D - transformations gives the difference between AMN & MNB (D) and its horizontal derivative - dD/dX (R) . ...

Еще в разделе: (Показать все результаты (>71) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... Statistical Model for Meteorolocal Elements Based on Local Radiosonde Measurements . ... The model is based on the 3-year local radiosonde measurements for the most important for practice strong winds for which the altitude level of the maximum wind is highly expressed. Vertical profiles of meteorological elements measured under quite different atmospheric conditions exhibit qualitative similarity, but differ by the reference scales of wind, temperature and altitudes. ...

Еще в разделе: (Показать все результаты (>103) - acs366.phys.msu.su/ )

• Abstract (Invited)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

Federation of European Societies on Trace Elements and Minerals PRELIMINARY SCIENTIFIC PROGRAM 09.06.2010 SESSION 1. Trace element and mineral analysis of environmental and biological samples: bulk determination, speciation and quality control. ... 10.06.2010 SESSION 2. ... SYMPOSIUM ORGANIZATION Venue The 4th International Symposium on Trace Elements and Minerals in Medicine and * Biology will take place in the Hotel "Okhtinskaya" (4, Bolsheokhtinsky prospect, 195027 St.Petersburg, Russia). ...

Еще в разделе: (Показать все результаты (>4) - www.fbm.msu.ru/ )