((tr|Q9HWZ3:27.13469,(((((tr|Q97JG6:73.32871,sp|P52281:58.21097):22.08826, . (tr|Q8Y6Z1:50.97049,(tr|Q9KDW9:31.89890,(tr|Q99UH4:56.31642, . sp|P18156:43.43318):19.58605):11.29379):3.59077):71.07033, . (sp|Q51389:17.43830,((tr|Q8ZJK5:16.37272,sp|P11244:16.30590):17.93318, . sp|P44826:37.32225):18.11240):90.64721):85.73800, . tr|Q97P66:72.12900):67.97217,tr|P73809:39.02698):25.46760):7.46192, . ((tr|Q92ZW9:33.27410,tr|Q8UJW4:14.11857):8.47005, . sp|Q9L772:29.68911):15.56444,sp|P48838:30.29193); .

Еще в разделе: (Показать все результаты (>4) - bioinf.fbb.msu.ru/ )

... http://edu-cons.net/svpaper4/ 10.12.2009 Untitled Document Page 2 of 40 , : « » ; () , , ; . ... Nature News ( 23 Sep 2002 ), doi: 10.1038/news020923-4, News http://www.nature.com/news/2002/020923/full/news020923-4.html http://edu-cons.net/svpaper4/ 10.12.2009 Untitled Document Page 39 of 40 3. ... . ... 1999-2000. 6. .., .. `` '', , `` ``'''', 2002. http://edu-cons.net/svpaper4/ 10.12.2009 Untitled Document Page 40 of 40 http://edu-cons.net/svpaper4/ 10.12.2009 ...

Еще в разделе: (Показать все результаты (>112) - higeom.math.msu.su/ )

• Toric Topology (English)

. Расплывание волнового пакета из 100 волн в результате дисперсии.

Еще в разделе: (Показать все результаты (>73) - genphys.phys.msu.su/ )

... About Journal | ... Sociology and Political Science publishes original works on sociology and political science, results of research and experiments in social and political spheres in Russia and abroad, methodological innovations, information about conferences, reviews of the recent books in sociology and political science. ... Please include full article title both in Russian and English. ... Information about the author/authors both in Russian and English. ... References. ...

Еще в разделе: (Показать все результаты (>52) - www.socio.msu.ru/ )

• English version - Социологический факультет МГУ

... Информационный портал о карьере и работе для студентов и выпускников технических и естественнонаучных специальностей . ... Ярмарка вакансий и стажировок для студентов и выпускников вузов . ... Management Information System (MIS) analyst, Junior systems analyst. Management Information System (MIS) analyst (reference code 'MIS') . Job profile: . Personal Installment Loans (PIL) & Credit Cards (CC) MIS development & maintenance . ... PIL & CC Ad-Hoc MIS Ideal candidate's profile: . ...

Еще в разделе: (Показать все результаты (>137) - www.physcareer.ru/ )

... Guidelines for Paper Submission . ... The program committee will schedule both oral and poster sessions. The abstract and summary of both oral and poster papers are published in the same manner in the Conference Program and the Technical Digest on CD-ROM. ... Oral Sessions . ... Poster Sessions . ... For poster sessions, authors are provided with bulletin boards on which to display their papers, along with a sign indicating their paper numbers, and pushтАУpins or adhesive tape. ... Program . ...

Еще в разделе: (Показать все результаты (>22) - iconolat13.phys.msu.ru/ )

Alexander P. Seyranian . Institute of Mechanics , . Moscow State Lomonosov University , . ... Phone: (7495) 939 2039 . Fax: (7495) 939 0165, 939 2065 . ... My field of specialization are Stability Theory, Parametric Resonance, Gyroscopic Stabilization, Mechanics of Solids, Structural Optimization, Singularities and Bifurcations. ... Technical University of Denmark . Aalborg University, Denmark . ... Institute of Engineering Mechanics and Systems, University of Tsukuba, Japan . ...

Еще в разделе: (Показать все результаты (>3) - seyranian.imec.msu.ru/ )

... TreeTop - Phylogenetic Tree Prediction . The source sequence multiple alignment could be formed from low and upper case letters. Upper case letters will show that there is a homology between correspondent fragments in alignment. ... Tree and Picture Options . Extra tree format . None Phylip Phylip (multiline) Nexus Nexus (TREES block only) Hennig86 . ... None Slanted Slanted 2 Rectangular Rectangular 2 Phylogram Unrooted Unrooted 2 . ... Alignment . Alignment example: . ...

Еще в разделе: (Показать все результаты (>161) - www.genebee.msu.ru/ )

• BLAST Reference Manual Pages
• Selected Scientific Journals - Search Engines
• RNA secondary structure prediction

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Узнать цвет пикселя. Работа с видеопамятью. С/С++ [ + OpenGL ? ... На входе координаты пикселя, на выходе например (255, 0, 0 ) если красный. ... OpenGL тебе не поможет. ...

Еще в разделе: (Показать все результаты (>1020) - www.snto-msu.net/ )

• [xslt2] error внутри variable - Public forum of MSU united student networks
• PhD Student Position in Near-field Optics - Public forum of MSU united student
• [News] Научное программное обеспечение - Public forum of MSU united student

... of Moscow State University Official Website . ... Faculty of Mechanics and Mathematics of Moscow State University, Russian Academy of Technical Sciences, Russian Academy of Natural Sciences, Council on Cybernetics of Russian Academy of Science, and Moscow Scientific Center for Culture and Information Technology organize the X International Conference "Intelligent Systems and Computer Science" at the Faculty of Mechanics and Mathematics of Moscow State University from December 05 to December 10, 2011...

Еще в разделе: (Показать все результаты (>58) - www.intsys.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... On this page we collect references to our resources, documentation and resources on other sites. All these data are very helpful for everybody who wants to learn practical quantum chemistry. Firefly (PC GAMESS) main page . ... ERG group wrote some articles about visualization: . ... Нет комментариев " Quantum chemistry information page " . ... Quantum chemistry information page . ... 2015 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>24) - erg.biophys.msu.ru/ )

• Using RESP with GAMESS-US and Firefly (PC-GAMESS) ERG Research Group:
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической
• Phase plane explorer ERG Research Group: Лаборатория теоретической биофизики

... Moscow State University Russian Language Centre . Moscow State University . ... Learn Russian at the Moscow State University! ... 28.05.2004 . New full on-line Russian language reference on our website! (more.. ... On April, 29, 2004 the rector of the Moscow M.V.Lomonosov State University academician V.A.Sadovnichy signed the order on creation of the Moscow school of economy of the Moscow M.V.Lomonosov State University. (more.. ... Space tourist calls Russian language his greatest challenge . ...

Еще в разделе: (Показать все результаты (>25) - www.rlcentre.com/ )

... 2013/04/16 - 11:59am . ... After the education at High School of Management and Innovation graduates receive the state approved diploma of Lomonosov Moscow State University for a specialized educational programme "Strategic Management and Innovation" and become "Masters of Management". ... Admission procedure in 2013 in direction of "Management" for the programme "Strategic Management and Innovation" provides for contracts with 50 persons . ... 2006-2016 MSU Higher School of Management and...

Еще в разделе: (Показать все результаты (>28) - hsmi.msu.ru/ )

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>2615) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• allpy: allpy/protein.py history

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>33) - seac47-2.phys.msu.ru/ )

... The RADEN data bank produced at the Department of Chemistry of Moscow State University is designed as well to accumulate published information on radiative parameters of diatomic molecules, as to analyse it and recommend the more reliable values. ... electronic transition moments D ( R ); . ... dipole moments, . ... FACTUAL RECOMMENDED DATABASE contains now the ab initio and experimental electronic transition moments for more than 250 band systems which belong to more than 100 diatomic molecules. ...

Еще в разделе: (Показать все результаты (>61) - electr003.chem.msu.ru/ )

Characterization of highly diverse viral populations by fast reference selection and accurate read mapping Gennady Fedonin Federal Budget Institution of Science Central Research Institute for Epidemiology , Moscow, Russia ... Bioinformatics, M.V. Lomonosov Moscow State University, Moscow, Russia, neva_2000@mail.ru Ability to characterize genetic composition of viral populations is critical to the selection of effective treatment of various viral infections ... Read mapping. ...

Еще в разделе: (Показать все результаты (>258) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/37.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf

. Set 1: List of species Reference tree . Set 2: List of species Reference tree . Set 3: List of species Reference tree . Set 4: List of species Reference tree . For the set 1 . For the sets 2 4

Еще в разделе: (Показать все результаты (>10) - mouse.genebee.msu.ru/ )

... Master Education . Second Education . ... Entrance requirements . ... personal statement addressed to the rector of MSU, containing the post-graduate course title and masters? program name . ... All applicants for full-time course (Russian students, both on scholarship and contract) are subject to following examinations: . ... All applicants to evening courses take an oral examination in the field of expertise. ... Второе высшее образование: second_edu@cs.msu.ru, 6-й этаж, комната 640, тел. ...

Еще в разделе: (Показать все результаты (>8) - hcs.cmc.msu.ru/ )

... Выпускники . ... The blood test is, when you think about it, a remarkable thing. ... Blood becomes data, and in these numbers lies knowledge about your current health, your risks for disease, and your potential response to treatment. ... The typical blood test report is an exercise in obfuscation, a document that needs to be translated by a lab technician or physician, and that's if you somehow manage to see a copy of your results. ... On the next few pages, Wired has given the lab report a makeover...

Еще в разделе: (Показать все результаты (>414) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Ученые обнаружили генетические корни интеллектуального