MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>5) - www.sciencepark.ru/ )

... 1066 , , , . ... Origin of the English language (parent language, family tree, cognates) Practical application of knowledge in the field of language history. ... Changes in: - Grammar - Vocabulary General (stages of development) - Spelling - Phonetic systems 8. Periods of the English language historical development. ... English Alphabet: changes and development from Old English to Modern English. ... Cambridge University Press, 2003. ... Oxford University Press, 2001. the English language. ...

Еще в разделе: (Показать все результаты (>64) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/future-students/lingua-4-teens/tezis-filosof.pdf

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>45) - sn.sai.msu.ru/ )

... The optimal control, which led oscillatory system to a certain energy level from any initial conditions at minimum time, is found. ... A set of points where the trajectory becomes an arc of a circle with the other center is called the switching line. ... For drawing switching line near the origin (see for example Figure 3) we note from the system (1) that time is proportional to the sum of the angles 214 this sums for optimal and quasi-optimal processes. ... The control function (14) is not optimal....

Еще в разделе: (Показать все результаты (>10) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/0910.3802.pdf
• http://belyakov.imec.msu.ru/papers/ENOC2008.pdf
• http://belyakov.imec.msu.ru/papers/Belyakov_rus.pdf

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>46) - cosmos.msu.ru/ )

• UNIVERSAT-2009: University Satellites in Space Sciences Education, Zvenigorod,
• Space Scientific and Education project of Lomonosov Moscow State University

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

Twilight observations with MASS/DIMM B. Safonov Sternberg Astronomical Institute Moscow State University Comprehensive Characterization of Astronomical Sites, 2010 B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 1 / 17 Why observe in twilight with MASS/DIMM? ... ASM includes 3 devices sensitive to background: guider, DIMM and MASS. B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 2 / 17 Background in guider. ...

Еще в разделе: (Показать все результаты (>14) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/OVoziakova_site2010.pdf.pdf

... Baybakov S.E., Bahareva N.S., Chuprunova N.S. Key questions of human physique theory (p. 31-41) During mathematical analysis of the height (H, m), mass (M, kg) and wrist circumference (C, dm) in 154 girls and 58 young men aged 19 years the fundamental dependence of expected body mass (Me) on its length, describing all normally built people, have been established (Me=kH3, where «k» was 12.68 conv. u for girls and 12.17 conv. u for young men). ... The analysis was conducted at two hierarchical levels....

Еще в разделе: (Показать все результаты (>23) - www.anthropos.msu.ru/ )

• http://www.antropos.msu.ru/zzx/11_2_en.doc

... Ultrastructural changes in the cell center during enterocyte differentiation in the mouse. Tsitologiia. ... Microtubule and intermediate filament patterns around the centrosome in interphase cells. ... The effect of the UV microirradiation of the centrosome on cell behavior. ... A stereoscopic analysis of the centrosome structure in tissue culture cells under the action of carbonyl cyanide p-trifluoromethoxyphenylhydrazone and ouabain Tsitologiia. ... Alieva IB, Vorob'ev IA, Chentsov YuS. ...

Еще в разделе: (Показать все результаты (>33) - cellmotility.genebee.msu.ru/ )

... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>32) - www.bukivedi.ru/ )

• www.99ru.ru

... In the first period, the earth had two near-collisions with Venus, the first being in the time of the Hebrew exodus from Egypt and the second being on the day during Joshua's campaigns when the sun and moon stood still; see the discussion of the ?record? of the eclipse of 1130 September 30 in Section 11.2. ... During the second period, the earth had two or more near-collisions with Mars, and Velikovsky [p. 218 and p. 241] gives exact dates for the first and last of them. ...

Еще в разделе: (Показать все результаты (>84) - hbar.phys.msu.ru/ )

• Historical Eclipses
• Robert R. Newton, The Secular Acceleration of the Earth's Spin
• R. R. Newton, "Two uses of ancient astronomy"

... Магистерское образование . ... Enterprise Information Infrastructure . This course is focused on enterprise infrastructure and integration technology. Course presents different approaches to enterprise architecture and modern solutions of information infrastructure problems. Course?s topics cover strategies that help large enterprises to increase the agility of their IT systems. ... Enterprise portal technology, including collaboration and knowledge management . ... FI- Master data . ...

Еще в разделе: (Показать все результаты (>8) - hcs.cmc.msu.ru/ )

• Master programљ"Decision Engineering in Economics and Finance" | Магистерское и

... Data . ... Planetary perturbations during geomagnetic storms are measured by the Dst index, which is the deviation of variation of the magnetic field from the undisturbed level, averaged over the values measured at the control chain of magnetic stations located in the low latitudes. ... To predict the hourly values of the Dst index, artificial neural networks (ANN) of perceptron type are used. ... Loading of the data on the values of the Dst index and forecast update are performed twice per hour. ...

Еще в разделе: (Показать все результаты (>8) - swx.sinp.msu.ru/ )

• SWX - Анализ

... Conference Venue . ... Latest achievements in the field of humic substances and natural organic matter (NOM) research . Theory and practice of a directed use of humic substances and other biologically active compounds in crop production and animal feed . ... Organic farming and ecoadaptive agriculture: the role of humic substances and other biologically active compounds . ... The school on isolation of humic substances (HS) using solid phase extraction (SPE) cartridges . ...

Еще в разделе: (Показать все результаты (>92) - mgumus.chem.msu.ru/ )

... Если в сложно-составных предложениях (т.е. в предложениях, состоящих из нескольких независимых предложений) независимые предложения разделяются сочинительными союзами ( and, but, or, nor, for, yet, so, as (в смысле since, because ), while (в смысле at the same time )), то перед этими союзами ставятся запятые: . ... He could go into debt for the sports car, or he could buy the much cheaper economy car . ... Запятая также может быть опущена, если одно из двух независимых предложений "короткое". ...

Еще в разделе: (Показать все результаты (>732) - num-anal.srcc.msu.ru/ )

. Last changed: 22.05.02 .

Еще в разделе: (Показать все результаты (>49) - old.philol.msu.ru/ )

• Large transportation networks with finite-dimensional state space. Asimptotic
• MSU-LGCLL:: Anatoliy A. Polikarpov - Some Factors and Regularities of
• MSU-LGCLL:: Anatoliy A. Polikarpov - Major Tendences in Micro- and

... Doronina L. , Volodin I., Volodina E. The arousal-related shifts in call characteristics of the defeated great gerbils Rhombomys opimus // 6th International Zoo and Wildlife Research Conference on Behaviour, Physiology and Genetics, Berlin, IZW, 2007, p. 77. ... Sibling aggression in lynx: traits and consequences // Advances in Ethology 38, Supplements to Ethology. ... Advances in Ethology, Contributions to the 5-th International Symposium on Physiology, Behaviour and Conservation of Wildlife. ...

Еще в разделе: (Показать все результаты (>49) - vertebrata.bio.msu.ru/ )

• Courses
• Выступления студентов и аспирантов на конференциях

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . Application of ferrites in gas sensors . The principal advantage of ferrite as compared to conventional sensor based on semiconductor materials of metal oxides is the ability to adjust their band structure , the nature of the active sites on the surface , changing the cation composition . ... 2008-2014 Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>11) - www.lssm.inorg.chem.msu.ru/ )

• The Laboratory of chemistry and physics of sensor and semiconductor materials |

... March, 2005 . ... Moscow State University Russian Language Centre . Moscow State University . ... Learn Russian at the Moscow State University! The Official MGU Hymn . ... MGU Russian Language Centre changed the prices for special offers and distance training web-page is coming soon. ... About 360 guests, among them the descendants of the noble families which are well known in Russia' history, gathered at prestigious London hotel Dorchester. (more.. ... download our flash movie about MGU . ...

Еще в разделе: (Показать все результаты (>4) - www.rlcentre.com/ )