To remove several files: find . name 'mtg_*' -print -exec rm {} \; . This will search for and remove all files starting with the expression mtg_ from the current directory and its subdirectories. To find and remove specific files: find . ... This removes all files in the current directory and its subdirectories with the filename extension .tmp which have not been changed within the last 30 days. To find and remove files interactively; find ~/Docs -name '*.ps' -print -ok rm {} \; . ...

Еще в разделе: (Показать все результаты (>768) - comet.sai.msu.ru/ )

• Examples of using the ln -s command
• Examples of passing arguments given to a command alias
• Example of customising the less command

This example shows how to make, store to file, and read a picture as a set of drawing commands. ... This example ** program may be used, distributed and modified without limitation. ** *****************************************************************************/ # include ctype.h # include qapplication.h # include qpainter.h # include qpicture.h # include qpixmap.h # include qwidget.h # include qmessagebox.h # include qfile.h void paintCar( QPainter *p ) // ...

Еще в разделе: (Показать все результаты (>659) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - application/application.cpp example file
• Qt Toolkit - movies/main.cpp example file
• Examples

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>235) - uneex.mithril.cs.msu.su/ )

• HelpOnMoinCommand/ExportDump - UNИX
• Index of /static/AltDocs_informatika2/Book2/ch_11_ruby/09_examples
• HelpOnTables - UNИX

... The package installer is a scripting framework for MoinMoin which simplifies installing and delivering extensions for MoinMoin very much. ... The script contains one command (sounds complicated but is not really, look at the examples below) per line and gets executed from top to bottom. ... AddRevision|filename|pagename|author|comment|trivial . ... ReplaceUnderlayAttachment|filename in zip file|filename|pagename|author|comment . ... AddAttachment|filename in zip file|filename|pagename|author|comment...

Еще в разделе: (Показать все результаты (>948) - uneex.lorien.cs.msu.su/ )

• htdbm - Manipulate DBM password databases - Apache HTTP Server
• Using rpm2cpio
• HelpOnMoinCommand/ExportDump - UNИX

... PHP 4 CVS only) fbsql_create_blob -- Create a BLOB . string fbsql_create_blob ( string blob_data [, resource link_identifier]) . ... php $link = fbsql_pconnect ("localhost", "_SYSTEM", "secret") or die ("Could not connect"); $filename = "blobfile.bin"; $fp = fopen($filename, "rb"); $blobdata = fread($fp, filesize($filename)); fclose($fp); $blobHandle = fbsql_create_blob($blobdata, $link); $sql = "INSERT INTO BLOB_TABLE (BLOB_COLUMN) VALUES ($blobHandle);"; $rs = fbsql_query($sql, $link); ?> ...

Еще в разделе: (Показать все результаты (>1006) - oit.cmc.msu.ru/ )

• fbsql_create_clob
• fbsql_num_rows
• mysql_num_rows

... In our example we will implement a simple parser, which recognize space delimited words and has only two types (3, word, Word; 12, blank, Space symbols). Identifiers were chosen to keep compatibility with default headline() , since we won't implement our version. ... Returns a pointer to the internal structure of a parser. ... This procedure will be called so long as the procedure return token type = 0. ... Testing: =# SELECT * FROM parse('testparser','That''s my first own parser'); tokid | ...

Еще в разделе: (Показать все результаты (>1410) - www.sai.msu.su/ )

• Zen: pgsql pitr
• Monitoring Options
• Open Source Convention

... pdb: use pdb code instead of sequence name as filename for example, if '1jcc_A' sequence was loaded, loading of pdb chain B from the same pdb file should not cause new download from pdb bank . ... line source . ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 9 self . ... 12 def attach ( self , widget ): . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 47 def insert ( self , * args , ** kw ): . ...

Еще в разделе: (Показать все результаты (>13007) - kodomo.fbb.msu.ru/ )

• allpy: ef6692b5ffbc sandbox/ttk.py
• allpy: b412a580e998 sandbox/ttk.py
• allpy: a3ffdddb2a72 sandbox/ttk.py

... Portable MPI Process Startup . ... In order that the ``standard'' command not be confused with existing practice, which is not standard and not portable among implementations, instead of mpirun MPI specifies mpiexec . ... Instead, MPI specifies an mpiexec startup command and recommends but does not require it, as advice to implementors. ... mpiexec -n <numprocs> <program> be at least one way to start <program> with an initial MPI_COMM_WORLD whose group contains <numprocs> processes. ... Центры . ...

Еще в разделе: (Показать все результаты (>442) - www.parallel.ru/ )

• Installing documentation | PARALLEL.RU - Информационно-аналитический центр по
• Client/Server Examples | PARALLEL.RU - Информационно-аналитический центр по
• mpif77 | PARALLEL.RU - Информационно-аналитический центр по параллельным

Электронная библиотека Попечительского совета . ... Quigley E. - UNIX Shells by Example . ... Название: UNIX Shells by Example . Автор: Quigley E. Аннотация: . The second edition of Unix Shells by Examples shows off basic commands and utilities in the three most popular Unix shells - C, Bourne, and Korn - with side-by-side examples. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>7530) - lib.mexmat.ru/ )

• Baird K.C. - Ruby by Example: Concepts and Code :: Электронная библиотека
• Albing C., Vossen JP, Newham C. - bash Cookbook: Solutions and Examples for
• Журнал Probability and Statistics by Example :: Электронная библиотека

... Line: 1 to 1 . ... Changed: . ... You could use also HTML tags for headings, e.g. <H4>This is an HTML heading</H4> will show up as: . ... Use the preformatted HTML tags to keep the new line of text as it is. Do so by enclosing the text with <PRE> and </PRE> tags, e.g. > . ... The pre tag is standard HTML; verbatim is a special TWiki tag that also forces text to fixed font mode, and also prevents other tags and TWiki shortcuts from being expanded. ... Use preformatted text with <PRE> tags. ...

Еще в разделе: (Показать все результаты (>40702) - dualopt1.cmm.msu.ru/ )

• TextFormattingFAQ - TWiki - TWiki
• %TOPICTITLE% (7 vs. 8) - TWiki

Next: A wavelet Up: No Title Previous: Introduction . Figure: Data characterization using wavelets. The time axis is common to the raw data and the wavelet map (background), for which the vertical axis is analogous to an inverse frequency (Section 10). The Mexican hat wavelet (Section 3) used for the background wavelet map (Section 5) measures the magnitudes of local maxima (blue-grey shades) and minima (yellow/red shades) as a function of time and duration. ...

Еще в разделе: (Показать все результаты (>6734) - crydee.sai.msu.ru/ )

• A Simple Example With a Single Chirp Component
• Long description for example showing how structurally overlapping cells are
• Dynamic HTML in Communicator

... The command to be executed can be given to pppd with the connect command line option. pppd will redirect the command's standard input and output to the serial line. ... Basically, a chat script consists of an alternating sequence of strings that we expect to receive from the remote system, and the answers we are to send. ... This is a typical excerpt from a chat script; ogin: b1ff ssword: s3kr3t This tells chat to wait for the remote system to send the login prompt, and return the login name b1ff. ...

Еще в разделе: (Показать все результаты (>560) - itpm.msu.su/ )

• htpasswd - Manage user files for basic authentication - Apache HTTP Server
• mod_file_cache - Apache HTTP Server
• mod_example - Apache HTTP Server

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>107) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias
• Apache's Handler Use
• Apache Multiple Log Files

... Given package is a set of special commands and their handler - JOB program. The command aimed for description of often performed operations with files of PC-GAMESS program (dat, out, pun). ... Commands allow running calculation, performing other programs, data change between files and modification of files. ... Command inserts specified group in file.inp. ... del_g h2o.dat |Command deletes all repetition of| |$basis |specified group in file.inp. ... Command changes contents of group on specified | ...

Еще в разделе: (Показать все результаты (>58) - classic.chem.msu.su/ )

• Firefly DOCUMENTATION - command line arguments
• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI
• Lesson 3: two methods for preparing Firefly' input files with basis sets and

... Trac has a built in small and powerful wiki rendering engine. ... Font Styles == The Trac wiki supports the following font styles: {{{ * '''bold''', '''!''' can be bold too''', and '''! ''' * ''italic'' * '''''bold italic''''' * __underline__ * {{{monospace}}} or `monospace` * ~~strike-through~~ * ^superscript^ * ,,subscript,, }}} Display : * '''bold''', '''!''' can be bold too''', and '''! ''' * ''italic'' * '''''bold italic''''' * __underline__ * {{{monospace}}} or ... Cell 1|| ... Display: |...

Еще в разделе: (Показать все результаты (>1828) - kodomo.cmm.msu.ru/ )

• Help: templating
• example.snake in snakes тАУ Python Battle
• WikiFormatting ? Tanchiki

... Write {{ note text }} anywhere in a topic. ... FOOTNOTE{LIST="Web.Topic"}% will be replaced by the notes from an %INCLUDE% ed page. ... Tim Berners-Lee{{Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS.}} invented the World Wide Web. ... Tim Berners-Lee (1) invented the World Wide Web. ... Notes 1 : Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS. ...

Еще в разделе: (Показать все результаты (>2183) - wiki.cs.msu.ru/ )

• YahooUserInterfaceContrib < System < Foswiki
• JQueryUITooltip < System < Foswiki
• IncludeTopicsAndWebPages < System < Foswiki

You are here: Foswiki > System Web > Plugins > FootNotePlugin (revision 1) Edit Attach . ... Write {{ note text }} anywhere in a topic. ... Tim Berners-Lee{{Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS.}} invented the World Wide Web. ... Tim Berners-Lee (1) invented the World Wide Web. ... Notes 1 : Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS. ... Webs . ...

Еще в разделе: (Показать все результаты (>6821) - wiki.cmc.msu.ru/ )

• FootNotePlugin < System < Foswiki
• PreferencesPlugin < System < Foswiki
• RegularExpression < System < Foswiki

... CDEPEND } dev-python /pytest[${ PYTHON_USEDEP }] ) RDEPEND= ${ CDEPEND } python_prepare_all() { local PATCHES=( ${FILESDIR} /python3.3-tests.patch ) distutils-r1_python_prepare_all } python_compile_all() { if use examples ; then cd docs / examples || die Couldn't change to docs / examples ${PYTHON} generate.py || die Couldn't generate ...

Еще в разделе: (Показать все результаты (>20278) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2087.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2087.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc860.txt

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>5) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости