... Command-line arguments for the application program . Up: Debugging MPI programs Next: Starting jobs with a debugger Previous: Debugging for Nexus . Arguments on the command line that follow the application program name and are not directed to the mpich system (don't begin with -mpi or -p4 ) are passed through to all processes of the application program. ... myprog x y z and your program can process its own command-line arguments in the normal way. ... Центры . ...

Еще в разделе: (Показать все результаты (>709) - www.parallel.ru/ )

• Running an MPI Program | PARALLEL.RU - Информационно-аналитический центр по
• Portable MPI Process Startup | PARALLEL.RU - Информационно-аналитический центр
• Heterogeneous networks and the ch_p4 device | PARALLEL.RU -

To check the identity of a single file: file ReportA ReportA: Frame Maker document . ... To check the identity of several files: file * external.c: c program text external.h: c program text mc: sparc demand paged dynamically linked executable mcXThelp: executable shell script mcdemo: executable shell script mchelp: executable shell script mchome: executable shell script mctools: executable shell script . This checks the identity of every file in the current directory. ...

Еще в разделе: (Показать все результаты (>803) - comet.sai.msu.ru/ )

• Examples of using the pr command
• Example of exiting mail with the "q" command
• Examples of getting files with the ftp program

This example continuously draws rectangles in a window and has another widget that counts the number of rectangles that are drawn per second. Id: forever.cpp,v 2.4 1998/06/16 11:39:32 warwick Exp $ ** ** Copyright (C) 1992-1998 Troll Tech AS. ... This file is part of an example program for Qt. ...

Еще в разделе: (Показать все результаты (>826) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - connect/connect.cpp example file
• Qt Toolkit - picture/picture.cpp example file
• Qt Toolkit - Example Programs

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>23) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• Nhunt

... This program was created for correlating chosen regions in the series of fts images. ... Chosen regions' . ... In this section the program counts the integral for each region of the grid for each image. ... As a matter of fact, the integral is total brightness of the region and it is counted by 'int_tabulated' IDL function. ... In addition, the program will show the count of the regions which correlate with the corresponding region (the brighter region means the bigger count) and its contour. ...

Еще в разделе: (Показать все результаты (>243) - lnfm1.sai.msu.ru/ )

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ... rotatelogs is a simple program for use in conjunction with Apache's piped logfile feature. ... CustomLog "|bin/rotatelogs /var/logs/logfile 86400" common . This creates the files /var/logs/logfile.nnnn where nnnn is the system time at which the log nominally starts (this time will always be a multiple of the rotation time, so you can synchronize cron scripts with it). ... time (localized) . ...

Еще в разделе: (Показать все результаты (>668) - itpm.msu.su/ )

• Dialing out with chat
• mod_ext_filter - Apache HTTP Server
• htpasswd - Manage user files for basic authentication - Apache HTTP Server

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . rotatelogs is a simple program for use in conjunction with Apache's piped logfile feature. ... CustomLog "|bin/rotatelogs /var/logs/logfile 86400" common . This creates the files /var/logs/logfile.nnnn where nnnn is the system time at which the log nominally starts (this time will always be a multiple of the rotation time, so you can synchronize cron scripts with it). ... time (localized) . ...

Еще в разделе: (Показать все результаты (>1074) - uneex.lorien.cs.msu.su/ )

• mod_ext_filter - Apache HTTP Server
• htdbm - Manipulate DBM password databases - Apache HTTP Server
• htpasswd - Manage user files for basic authentication - Apache HTTP Server

PHP Manual . Prev . Next . PHP 4 >= 4.0.0) array_count_values -- Counts all the values of an array . array array_count_values ( array input) . array_count_values() returns an array using the values of the input array as keys and their frequency in input as values. Example 1. array_count_values() example . array = array (1, "hello", 1, "world", "hello"); print_r(array_count_values ($array)); . ... Array ( [1] => 2 [hello] => 2 [world] => 1 ) . ... array_chunk . ...

Еще в разделе: (Показать все результаты (>1053) - oit.cmc.msu.ru/ )

• Apache HTTP Server: Security Tips
• Using PHP from the command line
• nmblookup (1)

Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index . To move the sample on the Z-axis fast (it may need in the end of the work, for example) use SPM/ Move sample menu command. This command allow to move the sample up (to the probe) or down (from the probe) at specified value. Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index Filonov 2005-02-04

Еще в разделе: (Показать все результаты (>199) - www.spm.genebee.msu.ru/ )

• Server configuration
• Additional commands
• Server

... Axelson J.L. - The Microcontroller Idea Book: Circuits, Programs and Applications Featuring the 8052-Basic Single-Chip Computer . ... Название: The Microcontroller Idea Book: Circuits, Programs and Applications Featuring the 8052-Basic Single-Chip Computer . ... About The Microcontroller Idea Book: . ... Example circuits and programs in the book are based on the popular 8052-BASIC microcontroller, whose on-chip BASIC programming language makes it easy to write, run, and test your programs. ...

Еще в разделе: (Показать все результаты (>13690) - lib.mexmat.ru/ )

• Поиск книг, содержащих Counter example :: Электронная библиотека
• Sobell M.G. - A Practical Guide to LinuxR Commands, Editors, and Shell
• KroahHartman G. - Linux Kernel in a Nutshell :: Электронная библиотека

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>138) - bioinf.fbb.msu.ru/ )

• Input Formats

... Given package is a set of special commands and their handler - JOB program. The command aimed for description of often performed operations with files of PC-GAMESS program (dat, out, pun). ... Commands allow running calculation, performing other programs, data change between files and modification of files. ... Command inserts specified group in file.inp. ... del_g h2o.dat |Command deletes all repetition of| |$basis |specified group in file.inp. ... Command changes contents of group on specified | ...

Еще в разделе: (Показать все результаты (>96) - classic.chem.msu.su/ )

• http://classic.chem.msu.su/gran/gamess/ff_openmpi.pdf
• PC GAMESS/Firefly DOCUMENTATION - running in parallel using LAM/MPI

We have prepared some summation programs for working with Reduce output. ... 1 in $COMPHEP/test/sum.red $ % loading the summation package in symb1.red $ % reading contributions of diagrams sum; % writing the answer (32*ee**4*(2* p1.p2 **4-4* p1.p2 **3* p1.p3 +3* p1.p2 **2* p1.p3 **2-2* p1.p2 **2* p1.p3 *me**2-p1.p2* p1.p3 **3 + 2* p1.p2 * p1.p3 **2*me**2 + p1.p3 **2*me**4)) /(propden(-p1-p2,me,0)**2*propden(p2-p3,me,0)**2)$ %2 in $COMPHEP/test/sum2pole.red $ % loading the ...

Еще в разделе: (Показать все результаты (>2016) - theory.sinp.msu.ru/ )

• The genEvents command
• Reduce program
• Concept of user program implementation

System parameters on Digital UNIX . ... Digital and Cray use the number of bytes as the KIND -parameter. ... LOGICAL Default byte word KIND number = 4 1 4 LOGICAL Default double quad KIND number = 4 8 16 INTEGER int15 int31 int63 KIND number = 2 4 8 digits = 15 31 63 radix = 2 2 2 range = 4 9 18 huge = 32767 2147483647 9223372036854775807 bit_size = 16 32 64 REAL single double quad KIND number = 4 8 16 digits = 24 53 113 maxexponent = 128 1024 16384 minexponent = -125 -1021 -16381 ...

Еще в разделе: (Показать все результаты (>3965) - crydee.sai.msu.ru/ )

• Use of program libraries
• NAG's Fortran 90
• Program units

Here is an example of an alignment for input for the program " Geometrical Core ". Note that the names of sequences should be of the form: . PDBcode_Chain[_Model] . 1ADR_A_2 LMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCS PDYLLKGD

Еще в разделе: (Показать все результаты (>6958) - mouse.belozersky.msu.ru/ )

• wLake program homepage
• LCore
• Geometrical core

Ken Harrenstien RFC-811 Vic White 1 March 1982 Elizabeth Feinler Network Information Center SRI International HOSTNAMES SERVER INTRODUCTION The NIC Internet Hostnames Server is an NCP/TCP-based host information program and protocol running on the SRI-NIC machine. ... The function of this particular server is to deliver machine-readable name/address information describing networks, gateways, hosts, and eventually domains, within the internet environment. ... Send comments to NIC@SRI-NIC. ...

Еще в разделе: (Показать все результаты (>24196) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc811.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc471.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc471.txt

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for increasing the colour depth of video (bits per pixel) while preserving details and borders. This filter utilizes multi-frame motion compensation and adaptive noise removal methods to increase color depth of video and preserve details. ... Filter was applied to colour depth increasing from 5 to 8 bits per channel. ...

Еще в разделе: (Показать все результаты (>846) - graphics.cs.msu.ru/ )

• GML Matting | Graphics and Media Lab
• Hide information in video | Graphics and Media Lab
• Removing of blocking effect from video | Graphics and Media Lab

... CREATE FULLTEXT CONFIGURATION -- create full-text configuration . CREATE FULLTEXT CONFIGURATION cfgname PARSER prsname [ LOCALE localename ] [ AS DEFAULT ]; CREATE FULLTEXT CONFIGURATION cfgname [ { PARSER prsname | ... PARSER . ... LOCALE . ... Create new configuration test with default parser and ru_RU.UTF-8 locale. CREATE FULLTEXT CONFIGURATION test PARSER default LOCALE 'ru_RU.UTF-8'; =# \dF+ test Configuration "public.test" Parser name: "pg_catalog.default" Locale: 'ru_RU.UTF-8' Token | ...

Еще в разделе: (Показать все результаты (>3066) - www.sai.msu.su/ )

• SAL- Computer Graphics, Images Signals - Modelers - Font3D
• Miscellaneous Options
• Linux Rescue Diskette

... line source . ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 12 def attach ( self , widget ): . ... 15 widget [ command ] = lambda * args , ** kw : self . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 41 def tag_clear ( self , tag ): . ... 47 def insert ( self , * args , ** kw ): . ... insert ( self , * args , ** kw ) . ... 53 def _select ( self , ev ): . ... 79 names . ... 80 sequences . ...

Еще в разделе: (Показать все результаты (>20562) - kodomo.fbb.msu.ru/ )

• allpy: b520e79fd1f4 docs/Makefile
• allpy: b412a580e998 allpy/block.py
• cca: a308291203ea Help/Help.html

Program ODF3 is elaborated for numerical simulation of the EPR spectra and determination of the spectra parameters by fitting procedure. ... The examples of results obtained using ODF3 are presented in chapter "Simulation of rigid limit and slow motion EPR spectra for extraction of quantitative dynamic and orientational information" (in "Nitroxides - Theory, Experiment and Applications", ISBN 979-953-307-1090-0.) ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>143) - www.chem.msu.ru/ )