... allpy/markups.py test/test_markups.py . ... allpy/markups.py . ... 1.1 --- a/ allpy / markups .py Tue Mar 06 16:08:49 2012 +0400 1.2 +++ b/ allpy / markups .py Tue Mar 06 20:29:34 2012 +0400 1.3 @@ -22,10 +22,13 @@ 1.4 global by_name 1.5 by_name = {} 1.6 for markup_class in globals().values(): 1.7 - if hasattr( markup_class , 'name') and hasattr( markup_class , 'kind'): 1.8 - fullname = markup _ class .kind, markup _ class .name 1.9 - assert fullname not in by_name, Samenamed ...

Еще в разделе: (Показать все результаты (>112876) - kodomo.fbb.msu.ru/ )

• allpy: bf873e4054c2 allpy/markups.py
• allpy: 5639138f619a
• allpy: df571a5233fb

... menu_file.add_command(label="New", command=handlers.new_file) €а . ... menu_file.add_command(label="New", command=handlers.new_file, accelerator="Ctrl+N") €а . ... menu_action.add_command(label="Start", command=handlers.start) €а . ... menu_action.add_command(label="Stop", command=handlers.stop) €а . ... menu_action.add_command(label="Start", command=handlers.start, accelerator="Ctrl+G") €а . ... menu_action.add_command(label="Stop", command=handlers.stop, accelerator="Ctrl+F") €а . ...

Еще в разделе: (Показать все результаты (>4016) - kodomo.cmm.msu.ru/ )

• Changeset 14:05518686d7af тАУ Petri Dish
• Changeset 13:f350d610c986 тАУ Petri Dish
• Changeset 6:721fdbb815c8 тАУ Cyclyc Cell Automata

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• ConClus

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6976) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Example of alignment
• Alignment example

A.N. Belozersky Institute . Bioinformatics Portal . ... Russian EMBnet Node . ... AliBee - Multiple alignment Release 2.0 . ... Grants information . ... Our Institute is a scientific department of Moscow State University. ... Address: Belozersky Institute,Moscow State University,Leninskie Gory 1,Bldg. ... Information about our activities and EMBnet resources around the World is available here . Information about our educational activities with kids, children and teenagers is available here . ...

Еще в разделе: (Показать все результаты (>90) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced
• GeneBee Graphical Alignment - Advanced

... All contacts alignment . ... Blue background means a contact with backbone phosphate. ... HBond with major groove + contact through a molecule of water with backbone phosphate; . ... contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + contacts through water molecules both with backbone phosphate and major groove; . ... HBond with major groove + engagement in hydrophobic cluster + contact through a molecule of water with backbone phosphate; ...

Еще в разделе: (Показать все результаты (>236) - monkey.belozersky.msu.ru/ )

• Inquiry information || Formats of alignments
• SDP home page
• SVETKA, a program for multiple sequence alignments analysus

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Given word length and max number of mismatches . Use MEME algorithm for define conserved blocks . Apply the Dynamic programming algorithm to create chain of the blocks . Refine the chain using combined profile for chain of blocks. ... Reduce word length and number of mismatches and repeat the procedure for spacer between the blocks. ... Create helix profile and apply MEME-like iterative procedure to find sets of helices that consistent lokated reative to conserved blocks . ...

Еще в разделе: (Показать все результаты (>16) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPpred
• Site Cluster

Электронная библиотека Попечительского совета . ... Takatoh K., Hasegawa M., Itoh N. - Alignment Technologies and Applications of Liquid Crystal Devices . ... Название: Alignment Technologies and Applications of Liquid Crystal Devices . Авторы: Takatoh K., Hasegawa M., Itoh N. Аннотация: . ... Alignment Technologies and Applications of Liquid Crystal Devices demonstrates both the fundamental and practical aspects of alignment phenomena in liquid crystals. ...

Еще в разделе: (Показать все результаты (>348) - lib.mexmat.ru/ )

• Boudreau R.A. - Passive Micro-Optical Alignment Methods :: Электронная
• Schmidt O.G. - Lateral Alignment of Epitaxial Quantum Dots :: Электронная
• Hoque F. - The Alignment Effect: How to Get Real Business Value Out of

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>64) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/161.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf

Alignment in free decaying MHD turbulence" . ... Using a shell model of turbulence, we have investigated a long-time evolution of magnetic and velocity fields in the MHD turbulence with various types of initial states. ... For most realizations, a coherent state with high alignment between the magnetic and velocity fields has been developed. In the case of establishment of the coherent state, the dissipation rate of energy is found to be substantially reduced. ...

Еще в разделе: (Показать все результаты (>2) - num-meth.srcc.msu.ru/ )

The QGroupBox widget provides a group box frame with a title. ... QGroupBox  ( QWidget * parent=0, const char * name=0 )  . QGroupBox  ( const char * title, QWidget * parent=0, const char * name=0 )  . const char*  title  () const . ... int  alignment  () const . ... Constructs a group box widget with no title. ... Constructs a group box with a title. ... Returns the alignment of the group box title. ... Sets the alignment of the group box title. ... Sets the group box title text to title. ...

Еще в разделе: (Показать все результаты (>50) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QBoxLayout Class
• Qt Toolkit - QLabel Class

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>40) - uneex.lorien.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

... О UNИX . ... HelpOnImages . Неизменяемая страница . ... Working With Images . ... If you just want to get an image on a page, simply upload the image file (using the 'Attachments' link). ... For example, if you put large image {{attachment:duckie.png}} into the middle of a paragraph, like this , then that's exactly what you'll get. ... This example uses a chair image that's aligned left. Notice that paragraph text flows around it, so you can (for example) stagger images on the page. ...

Еще в разделе: (Показать все результаты (>21) - uneex.mithril.cs.msu.su/ )

• HelpOnTables - UNИX
• WikiCourse/15 Tables - UNИX

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>104) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - DCSE
• SAL- Other Scientific Fields - Chemistry, Biology Related - ClustalW
• SAL- Other Scientific Fields - Chemistry, Biology Related - HMMER

. Search: . Login . Preferences . About Trac . Timeline . Roadmap . Browse Source . View Tickets . Search . Reverse Diff . (No files) . Note: See TracChangeset for help on using the changeset viewer. Unified Diff . Zip Archive . Powered by Trac 0.12.5 . By Edgewall Software . Visit the Trac open source project at . http://trac.edgewall.org/

Еще в разделе: (Показать все результаты (>57) - kodomo.cmm.msu.su/ )

-3600 # Node ID 4a6d258b467f661da0894cc60ecd060f2e3c67c7 # Parent 301ce2788826a2d4d2725bd5cf01e998638db37a Provide default for BMOD_1_TO_MOD_1_THRESHOLD . diff -r 301ce2788826 -r 4a6d258b467f mpn / powerpc64 / mode64 / gcd_1.asm --- a/ mpn / powerpc64 / mode64 / gcd_1.asm Tue Mar 25 15:34:52 2014 + 0100 +++ b/ mpn / powerpc64 / mode64 / gcd_1.asm Wed Mar 26 12:57:48 2014 + ...

Еще в разделе: (Показать все результаты (>2544) - mirror.msu.net/ )

• http://mirror.msu.net/pub/slackware-current/source/installer/dropbear/dropbear.glibc.crypt.diff
• http://mirror.msu.net/pub/gentoo-portage/www-apps/trac-downloads/trac-downloads-0.3_p9282.ebuild
• http://mirror.msu.net/pub/gentoo-portage/app-crypt/jetring/jetring-0.21.ebuild

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... TablePlugin 10 - 2002-03-07 - PeterThoeny . ... Table cell spacing. ... Set CELLSPACING = 1 . ... 05 Jan 2002 PTh: Fixed sorting bug of cells with leading white space . 06 Dec 2001 PTh: Fixed date sorting bug . 03 Dec 2001 PTh: Fixed sort="off" bug and more . 29 Nov 2001: PTh fixed Perl warnings . 16 Nov 2001: PTh added table border, cell spacing, cell padding, gif files . ...

Еще в разделе: (Показать все результаты (>32028) - dualopt1.cmm.msu.ru/ )

• VarTABLE - TWiki - TWiki
• %TOPICTITLE% ( vs. 1) - TWiki
• VarTABLE - TWiki - TWiki - (printable)

... Planets In The Sun . ... Credit Copyright: SOHO - LASCO Consortium, ESA , NASA Explanation: Today , all five naked-eye planets (Mercury, Venus, Mars, Jupiter, Saturn) plus the Moon and the Sun will at least approximately line-up. ... And what about the Moon ? ... Publications with keywords: Jupiter - Mars - planet - Saturn - Sun - planetary alignment - Moon . Publications with words: Jupiter - Mars - planet - Saturn - Sun - planetary alignment - Moon . ... Neon Saturn . ... Moons and Jupiter . ...

Еще в разделе: (Показать все результаты (>2858) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Venus, Moon, and Neighbors
• Астронет > Venus, Moon, and Neighbors

This diagram shows how the 'vertical-align' properties on cells combine to determine the height of the row containing the cells. The diagram also illustrates the meaning of some values of 'vertical-align' that apply to table cells: baseline, top, bottom, and middle. The diagram shows a row of five (labeled) table cells of varying heights and alignments. ... The first cell is aligned with the row baseline and extends to just below the row top. ...

Еще в разделе: (Показать все результаты (>153) - crydee.sai.msu.ru/ )

• Alignment, font styles, and horizontal rules in HTML documents