The method of gene expression analysis in complex morphological systems A.V. Klepikova, N.V. Demidenko, M.D. Logacheva, A.A. Penin M.V. Lomonosov Moscow State University, Moscow, Russia , annklepikova@gmail.com, demidenkonatalia@gmail.com, maria.log@gmail.com, alekseypenin@gmail.com Investigation of gene expression level is a powerful approach in functional genetics. ... 2010) Identification of genes correlated with early stage bladder cancer progression, Cancer Prev Res (Phila), 3(6):776­786. ...

Еще в разделе: (Показать все результаты (>352) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/155.pdf

... MPI_Comm_compare . ... All MPI routines in Fortran (except for MPI_WTIME and MPI_WTICK ) have an additional argument ierr at the end of the argument list. ierr is an integer and has the same meaning as the return value of the routine in C. In Fortran, MPI routines are subroutines, and are invoked with the call statement. ... All MPI routines (except MPI_Wtime and MPI_Wtick ) return an error value; C routines as the value of the function and Fortran routines in the last argument. ... Центры . ...

Еще в разделе: (Показать все результаты (>375) - www.parallel.ru/ )

• Constants | PARALLEL.RU - Информационно-аналитический центр по параллельным

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. 2001 February 26 . Sand Dunes on Mars . Credit: Malin Space Science Systems , MGS , JPL , NASA . Explanation: Sand dunes on Mars can appear exotic. ... These particular dunes are located in Proctor Crater , a 170 kilometer wide crater first seen to house sand dunes by Mariner 9 more than 25 years ago. ... About APOD | ...

Еще в разделе: (Показать все результаты (>8885) - www.sai.msu.su/ )

• SAL- Scientific Data Processing Visualization - Software Packages - EnSight
• APOD: 2015 January 21 - The Complex Ion Tail of Comet Lovejoy
• APOD: 2000 August 9 - A Solar Filament Lifts Off

... Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: Compare Prices Online . ... Once you use it <a href=http://biafloyy0.blog.com/>site here</a> buying Multi Profit Monthly . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . Вы не можете публиковать новые темы в этом форуме . ...

Еще в разделе: (Показать все результаты (>5340) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: tax of goods compared that
• Экологический Форум - Фундаментальная Экология: Compare Shopping
• Экологический Форум - Фундаментальная Экология: materials compared for yuan;

Russian abstract] . Russian full text] . The classifications revealed by geometric morphometry and classical morphometry for Drosera rotundifolia , D. obovata , D. anglica and D. linearis were compared. ... the form of petiole middle part transverse section is the effective distinguishing character for the some different species and inter-species hybrids of Drosera ; . the consensus configurations are preferable for the geometric morphometry analysis of populations. ...

Еще в разделе: (Показать все результаты (>235) - herba.msu.ru/ )

• The behavior of Nymphaea flowers

... Applications of Molecular Mechanics to Metal Complexes" . ... Molecular mechanics study of the mixed-ligand lanthanide complexes using Gillespie-Kepert model . ... Within MM-GK, the same parameters are applicable to complexes of different coordination numbers/polyhedra. ... Gillespie-Kepert model . ... Using derived computational parameters, we calculated the geometry of 39 lanthanide ion nonaaqua complexes, 6 octaaqua complexes and 18 beta- diketonate and aqua-beta-diketonate complexes. ...

Еще в разделе: (Показать все результаты (>42) - analyt.chem.msu.ru/ )

Электронная библиотека Попечительского совета . ... Hartle T. - Comparing Indicators: Stochastics %K versus Williams' %R . ... Название: Comparing Indicators: Stochastics %K versus Williams' %R . Автор: Hartle T. Аннотация: . ... An example of this situation is the application of the stochastics indicator (%K) and Williams' %R. Both indicators are overbought/oversold oscillators. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>13087) - lib.mexmat.ru/ )

• Carstensen B. - Comparing and predicting between several methods of measurement
• Jensen H.J. - Self-Organized Criticality: Emergent Complex Behavior in Physical
• Reichardt J. - Structure in Complex Networks :: Электронная библиотека

... In order to compare the number of different evolutionary stages obtained and X-ray luminosity of the chosen X-ray sources with the observed galactic values we use the sum of C/O+O/C , where C and O are the calculated and observed values of a given binary type, respectively. If we make comparison for a number of different binary species (for example, we compare the number of CV, number of X-ray pulsars,   total X-ray luminosity of LMXB, etc.), we write this criterion in the form: . ...

Еще в разделе: (Показать все результаты (>377) - xray.sai.msu.ru/ )

• Basic Observational Data for Determination of f(q) and

Kinetics of redox reactions of Pu(V) in solutions containing different fractions of humic substances O.A. Blinova*, A.P. Novikov, I.V. Perminova+, R.G. Haire *A.N.Frumkin Institute of Physical Chemistry and Electrochemistry, Moscow , Russia , Vernadsky Institute of Geochemistry and Analytical Chemistry, Moscow , Russia , + Lomonosov Moscow State Univercity, Moscow , Russia , Oak Ridge National Laboratory Humic ...

Еще в разделе: (Показать все результаты (>181) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2008/2008-karpiouk-synthesis.pdf
• Humates NATO ARW picture gallery of the events

О лаборатории . ... Лаборатория теоретической биофизики . ... Posted by comcon1 in Без рубрики . ... PyMol is a powerful drawing instrument and here we show how to plot Fukui function with PyMOL after two calculation steps with FireFly (PC-GAMESS). continue reading.. ... To build topology for the new molecule partial charges for atoms should be determined. ... OPLS-AA patch for different types of molecules . ... comcon1 in All-atom automatic OPLS-AA topology? . ... 2012 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>59) - erg.biophys.msu.ru/ )

• comcon1 ERG Research Group: Лаборатория теоретической биофизики
• pymol ERG Research Group: Лаборатория теоретической биофизики
• gromacs ERG Research Group: Лаборатория теоретической биофизики

... Ivanovo State University . My experience as a Fulbright scholar in the USA gave me an ample opportunity to compare the structure, functions and modes of self-identification in the US and Russian academic communities. Overall, the American university system seemed more flexible and capable of self-adjusting to the demands of the moment. ... Though Russia is far behind the USA in technology and electronic media, we still can adopt some American educational technologies. ...

Еще в разделе: (Показать все результаты (>135) - www.prof.msu.ru/ )

• Training For Effective Intercultural Communication
• Eleven years of independence
• FOREIGN LANGUAGES AND CULTURE EDUCATION THROUGH THE DIALOGUE OF CULTURES

PHP Manual . ... The switch statement is similar to a series of IF statements on the same expression. ... if ($i == 0) { print "i equals 0"; } if ($i == 1) { print "i equals 1"; } if ($i == 2) { print "i equals 2"; } switch ($i) { case 0: print "i equals 0"; break; case 1: print "i equals 1"; break; case 2: print "i equals 2"; break; } . ... Only when a case statement is found with a value that matches the value of the switch expression does PHP begin to execute the statements. ...

Еще в разделе: (Показать все результаты (>229) - oit.cmc.msu.ru/ )

• Complex Types
• version_compare
• mcal_date_compare

Comparative mineralogy of carbonatite complexes belonging to different formations . ... I. Within well known formation of ultrabasic -alkaline rocks within carbonatites (UAC), the main rare metal ore components are Nb, Zr, REE Ce , rarely Sr, Ba, U, Ta, Th, as well as phosphorus in apatite, in zones of hypergenesis – minerals of crandallite group and others; fluorite, Fe in magnetite, rarely hematite and its hydroxides, sulfides of non-ferrous metals – Cu, Zn and others. ...

Еще в разделе: (Показать все результаты (>671) - geo.web.ru/ )

• http://geo.web.ru/conf/alkaline/2009/Kryvdik.htm
• http://geo.web.ru/conf/alkaline/2009/Yakovleva_et_al.htm
• http://geo.web.ru/conf/alkaline/2009/ZaitsevV4.htm

... Different domain organization of two main conformational states of Na+/K+-ATPase]. ... The melting curves for the apoforms of Na+/K+-ATPases have different shapes: the curve for the enzyme from the rabbit shows one transition at 56.1 degrees C, whereas the denaturation of Na+/K+-ATPase from the duck is characterized by two transitions, at 49.8 and 56.9 degrees C. Sodium and potassium ions abolish the difference in the domain organization of Na+/K+-ATPases. ...

Еще в разделе: (Показать все результаты (>138) - biochem.bio.msu.ru/ )

• Measurement of B-type natriuretic peptide by two assays utilizing antibodies
• Spectral and kinetic parameters of phosphorescence of triplet chlorophyll a in
• Heterooligomeric complexes formed by human small heat shock proteins HspB1

... Recent research of the Laboratory of Photochemistry is concerned mainly with the problems of mechanisms and kinetics of several kinds of photoreactions in homogeneous media and in organized molecular systems. ... Electron Transfer Mechanism Exciplexes . Chain ion-radical reactions of photosubstitution in aromatic compounds . ... Electron transfer mechanisms of exciplex and excimer formation reactions kinetics were studied by fluorescence spectroscopy and flourescence kinetics methods. ...

Еще в разделе: (Показать все результаты (>1195) - chem.msu.ru/ )

• Separation selectivity of anionic metal complexes of
• Moscow University Chemistry Bulletin Vol. 42, No. 5, P. 300 (2001)
• The anomalous behaviour of the non-selective ionisation signal pulse under

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>428) - rtm-cs.sinp.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>234) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services
• razjivin_dept
• GeneBee BLAST 2.2.22+ Services

Ochotona princeps and O. hyperborea . Comparative skull morphology of two pika species ( Ochotona princeps and O. hyperborea ): implications for differences in feeding habits . ... To examine the hypothesis that cranium and mandible morphology influence different feeding habits in pikas, we compared two samples: Ochotona princeps from California and Nevada, USA and O. hyperborea from Hokkaido, Japan. ... The Pikas // Chapman J.A. Flux J.E.C. (eds.). ... Ochotona hyperborea // Mammalian Species. ...

Еще в разделе: (Показать все результаты (>1582) - zmmu.msu.ru/ )

• Biochemical analysis of the metabolism of small rodents living in different
• Russian Journal of Theriology
• Inherited dental anomalies in the horse (Equidae, Equus caballus)

... Also during this work Dian drank a lot of tea with sugar, completed his description of urban and rural life (to the tunes of world-known musical "Notre-Dame de Paris"), wrote several poems about his dear friend GVR. ... Besides this project, Sergei A. Spirin with his colleague Andrew V. Alexeevski takes a very great part in different researches. Near their work room on the 3rd floor of the "A" laboratory building, near with the biological one, different colourful posters can be watched. ...

Еще в разделе: (Показать все результаты (>360) - monkey.belozersky.msu.ru/ )

• About this project
• About COGs

Organization of parallel computations when solving the inverse problem of wave diagnostics" . ... This paper deals with the development of methods and algorithms for solving the nonlinear three-dimensional inverse problem of wave diagnostics of irregularities in homogeneous media. A number of approaches used to choose the algorithms and organization of parallel computations for this problem are analyzed. ... PostScript (in Russian) (19.8MB) . PDF (in Russian) (288KB) . ...

Еще в разделе: (Показать все результаты (>278) - num-meth.srcc.msu.ru/ )

• "Sink-algorithms for the simulation of electron transfer kinetics"
• "Optimization algorithms for facet models and methods of their network...
• "Correction of solar dopplergrams' large-scale flatfield"