When sending a mail message to a user on the same system: jane . This is the address for the user jane on the same system as the person sending the mail. When sending a mail message to a user on another local system: ezax@frolix . This is the address for the user known as ezax on another local system frolix . When sending a mail message to a user on another system in another domain : helper@ubik.ed . ... This is the address for mail to the user ivan on another system, islay . ...

Еще в разделе: (Показать все результаты (>510) - comet.sai.msu.ru/ )

• Examples of using the diff command
• Example of contrasting files with the sdiff command
• Examples of sending Cc: and Bcc: copies

This module is contained in the mod_auth_anon.c file and is not compiled in by default. It is only available in Apache 1.1 and later. It allows "anonymous" user access to authenticated areas. It does access control in a manner similar to anonymous-ftp sites; i.e. have a 'magic' user id 'anonymous' and the email address as a password. ... This would allow the user to enter without password verification by using the userId's 'anonymous', 'AnonyMous','Not Registered' and 'I Don't Know'. ...

Еще в разделе: (Показать все результаты (>639) - rtm-cs.sinp.msu.ru/ )

• Examples
• Issues Regarding DNS and Apache
• Apache module mod_example

Modules | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... Allows "anonymous" user access to authenticated areas . ... This module does access control in a manner similar to anonymous-ftp sites; i.e. have a 'magic' user id 'anonymous' and the email address as a password. ... When set On the 'password' entered is checked for at least one '@' and a '.' to encourage users to enter valid email addresses (see the above Anonymous_LogEmail ). ...

Еще в разделе: (Показать все результаты (>925) - uneex.lorien.cs.msu.su/ )

• ADDRESS
• mod_vhost_alias - Apache HTTP Server
• mod_example - Apache HTTP Server

Modules | ... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... Allows "anonymous" user access to authenticated areas . ... This module does access control in a manner similar to anonymous-ftp sites; i.e. have a 'magic' user id 'anonymous' and the email address as a password. ... When set On the 'password' entered is checked for at least one '@' and a '.' to encourage users to enter valid email addresses (see the above Anonymous_LogEmail ). ...

Еще в разделе: (Показать все результаты (>576) - itpm.msu.su/ )

• Local Users
• Delivering Messages to Local Addresses
• Email Addresses

nmblookup - NetBIOS over TCP/IP client used to lookup NetBIOS names . nmblookup [ -M ] [ -R ] [ -S ] [ -r ] [ -A ] [ -h ] [ -B broadcast address ] [ -U unicast address ] [ -d debuglevel ] [ -s smb config file ] [ -i NetBIOS scope ] [ -T ] name . This program is part of the Samba suite. nmblookup is used to query NetBIOS names and map them to IP addresses in a network using NetBIOS over TCP/IP queries. ... S Once the name query has returned an IP address then do a node status query as well. ...

Еще в разделе: (Показать все результаты (>943) - oit.cmc.msu.ru/ )

• imap_rfc822_write_address
• Apache module mod_auth_anon.c
• ip2long

... Correct use of addresses . ... Thus, the use of addresses , that is, displacements relative to the start address MPI_BOTTOM, has to be restricted. Variables belong to the same sequential storage if they belong to the same array, to the same COMMON block in Fortran, or to the same structure in C. Valid addresses are defined recursively as follows: . ... A correct program uses only valid addresses to identify the locations of entries in communication buffers. ... Advice to users. ... Центры . ...

Еще в разделе: (Показать все результаты (>563) - www.parallel.ru/ )

• Examples | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Gather | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Gather-to-all | PARALLEL.RU - Информационно-аналитический центр по параллельным

Internet Engineering Task Force (IETF) J. Arkko Request for Comments: 5737 Ericsson Updates: 1166 M. Cotton Category: Informational L. Vegoda ISSN: 2070-1721 ICANN January 2010 IPv4 Address Blocks Reserved for Documentation Abstract Three IPv4 unicast address blocks are reserved for use in examples in specifications and other documents. This document describes the use of these blocks. ... Introduction This document describes three IPv4 address blocks that are provided for use in documentation. ...

Еще в разделе: (Показать все результаты (>28866) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5737.txt.pdf
• http://mirror.msu.net/pub/slackware-current/source/n/wireless-tools/scripts/rc.wireless.conf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc3849.txt

This module provides support for dynamically configured mass virtual hosting . ... Source File: mod_vhost_alias.c . ... For simple name-based virtual hosts you might use the following directives in your server configuration file: UseCanonicalName Off VirtualDocumentRoot /usr/local/apache/vhosts/%0 . A request for http://www.example.com/directory/file.html will be satisfied by the file /usr/local/apache/vhosts/www.example.com/directory/file.html . ... Module: mod_vhost_alias . ...

Еще в разделе: (Показать все результаты (>116) - neptun.sai.msu.ru/ )

• Issues Regarding DNS and Apache
• Apache module mod_auth_anon.c
• Apache module mod_example

Электронная библиотека Попечительского совета . ... Gay W.W. - Linux Socket Programming by Example . ... Название: Linux Socket Programming by Example . Автор: Gay W.W. Аннотация: . Linux Socket Programming by Example begins with a very basic introduction to the fundamentals of socket level programming. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>11009) - lib.mexmat.ru/ )

• Walser H., Pedersen J. - 99 Points of Intersection: Examples, Pictures, Proofs
• Vaughn W.R. - ADO Examples and Best Practices :: Электронная библиотека
• Powell G., McCullough-Dieter C. - Oracle SQL: Jumpstart with Examples ::

... BulkRegistration . Administrators can use this topic to register (i.e. create logins and user topics) for a group of people in one batch. ... Note that the new users are not notified that they have an account. ... In the REGISTERTOPIC topic: create a table of new users. ... This table is a template for user data that will be written to the new user topics. ... User | ... You can write additional data to the new user topics. ... Any fields you define in this table will end up in the User's topic. ...

Еще в разделе: (Показать все результаты (>40216) - dualopt1.cmm.msu.ru/ )

• BulkRegistration - TWiki - TWiki - (printable)
• %TOPICTITLE% (3 vs. 4) - TWiki
• %TOPICTITLE% (8 vs. 9) - TWiki

... We are pleased to inform you that Federation of European Societies of Plant Physiology (FESPP), Russian Academy of Sciences (RAS), Ministry of Education of Russian Federation, Division of Physico-Chemical Biology RAS, Russian Society of Plant Physiologists, Scientific Council of Plant Physiology and Photosynthesis RAS, K.A.Timiryazev Institute of Plant Physiology RAS and Russian Peoples' Friendship University are ... Lev N. Andreev (Moscow, Russia) . ... TUESDAY, OCTOBER, 23rd ...

Еще в разделе: (Показать все результаты (>125) - herba.msu.ru/ )

Administrators can use this topic to register (i.e. create logins and user topics) for a group of people in one batch. ... First time use) Create new bulk registration topics (see Settings below). In the REGISTERTOPIC topic: create a table of new users. ... This table is a template for user data that will be written to the new user topics. ... Any fields you define in this table will end up in the User's topic. ... This topic: System > WebHome > ReferenceManual > ManagingUsers > BulkRegistration . ...

Еще в разделе: (Показать все результаты (>7007) - wiki.cmc.msu.ru/ )

• WebNotify < _default < Foswiki
• WebNotify < Practicum < Foswiki
• WebNotify < Lectures < Foswiki

... In our example we will implement a simple parser, which recognize space delimited words and has only two types (3, word, Word; 12, blank, Space symbols). Identifiers were chosen to keep compatibility with default headline() , since we won't implement our version. ... Returns a pointer to the internal structure of a parser. ... This procedure will be called so long as the procedure return token type = 0. ... Testing: =# SELECT * FROM parse('testparser','That''s my first own parser'); tokid | ...

Еще в разделе: (Показать все результаты (>2393) - www.sai.msu.su/ )

• FTS Dictionary Example
• FTS Overview
• Parser sources

... HelpOnMacros/MailTo . ... Using the MailTo -Macro helps you putting your email address into a wiki in a rather safe way without having to fear that it gets collected by spam bots (robots collecting email addresses) and abused by some spammer. MailTo(Firstname DOT Lastname AT example DOT net)>> . ... MailTo(Firstname DOT Lastname AT example DOT net, link text)>> . ... Firstname DOT Lastname AT example DOT net . ... DOT . ... MailTo(Firstname DOT Lastname AT example DOT net, "Me, Myself, and I")>> . ...

Еще в разделе: (Показать все результаты (>272) - uneex.mithril.cs.msu.su/ )

• LecturesCMC/PythonIntro2014/06_FilesModulesSystem/Examples - UNИX
• Index of /static/GimpDoc_EnRu/images/dialogs/examples
• Index of /static/GimpDoc_EnRu/images/filters/examples

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>134) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Screening by similarity
• screening by keywords

System parameters on Digital UNIX . ... Digital and Cray use the number of bytes as the KIND -parameter. ... LOGICAL Default byte word KIND number = 4 1 4 LOGICAL Default double quad KIND number = 4 8 16 INTEGER int15 int31 int63 KIND number = 2 4 8 digits = 15 31 63 radix = 2 2 2 range = 4 9 18 huge = 32767 2147483647 9223372036854775807 bit_size = 16 32 64 REAL single double quad KIND number = 4 8 16 digits = 24 53 113 maxexponent = 128 1024 16384 minexponent = -125 -1021 -16381 ...

Еще в разделе: (Показать все результаты (>4951) - crydee.sai.msu.ru/ )

• A Simple Example With a Single Chirp Component
• Long description for example showing how structurally overlapping cells are
• One example

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: shall year June best example, essence tax . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2182) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Gucci the The example, people
• Экологический Форум - Фундаментальная Экология: on the will example, refine
• Экологический Форум - Фундаментальная Экология: example, IWC such I is States.

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>62) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.