Электронная библиотека Попечительского совета . ... Hartle T. - Comparing Indicators: Stochastics %K versus Williams' %R . ... Название: Comparing Indicators: Stochastics %K versus Williams' %R . Автор: Hartle T. Аннотация: . ... An example of this situation is the application of the stochastics indicator (%K) and Williams' %R. Both indicators are overbought/oversold oscillators. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>9922) - lib.mexmat.ru/ )

• Carstensen B. - Comparing and predicting between several methods of measurement
• Lewis M. - Comparing, Designing, and Deploying VPHs :: Электронная библиотека
• Friedman E., Gilley B. - Asia's Giants: Comparing China and India ::

... Faculty of Physics . M.V.Lomonosov Moscow State University . 7 (495) 939-16-82 info@physics.msu.ru . ... Contacts . ... Research Centers . ... Search Faculties Staff . Education . ... Research . ... Education research . ... 7 495 939-16-82, . ... Faculty of Physics, 2016 . ... official site . the Ministry of Education and Science . ... official site <div><img src="https://mc.yandex.ru/watch/35023620" style="position:absolute; left:-9999px;" alt="" /></div> ...

Еще в разделе: (Показать все результаты (>218) - phys.msu.ru/ )

• Физический факультет МГУ им. М. В. Ломоносова

... Land Hydrology . ... Recreational Geography and International Tourism . ... Economic and Social Geography of Russia . ... Departments . ... Main accomplished research: River hydrology, limnology, hydrometry, water quality, flow hydraulics, hydrological predictions, fluvial processes, hydrophysics, hydrogeology, water management, water ecology. ... Large international conferences were organized by Hydrology Department for the last years ? for example X Symposium on River Sedimentation (2007). ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Department of Cryolithology and Glaciology

... In order to compare the number of different evolutionary stages obtained and X-ray luminosity of the chosen X-ray sources with the observed galactic values we use the sum of C/O+O/C , where C and O are the calculated and observed values of a given binary type, respectively. If we make comparison for a number of different binary species (for example, we compare the number of CV, number of X-ray pulsars, ? total X-ray luminosity of LMXB, etc.), we write this criterion in the form: . ...

Еще в разделе: (Показать все результаты (>390) - xray.sai.msu.ru/ )

• Basic Observational Data for Determination of f(q) and

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: tax of goods compared that Luxus. times. ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>4124) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Compare Shopping
• Экологический Форум - Фундаментальная Экология: Compare Prices Online
• Экологический Форум - Фундаментальная Экология: Compare that to our neighbors

Synthesis of Alkoxysilylated Humic Derivatives with Different Modification Rate Capable of Self-Adhering to Mineral Surfaces Leonid A. Karpiouk1, Irina V. Perminova1, Sergey A. Ponomarenko2, Aziz M. Muzafarov2, Kirk Hatfield 1 3 Department of Chemistry, Lomonosov Moscow State University, 119992, Moscow, Russia, Institute of Synthetic Polymer Materials, Profsoyuznaya str., ... It is aimed at modification of carboxyl groups available within HS with 3-amino-propyltrimethoxy-silane (APTS). ...

Еще в разделе: (Показать все результаты (>192) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2010/2010-garanin-synthesis.pdf
• http://www.mgumus.chem.msu.ru/publication/2007/shcherbina-sequestration-2007.pdf
• http://www.mgumus.chem.msu.ru/publication/2008/2008-philippova-mitigating.pdf

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. 2012 May 11 . Sun vs. Super Moon . ... Explanation: The Super Moon wins , by just a little, when its apparent size is compared to the Sun in this ingenious composite picture. To make it, the Full Moon on May 6 was photographed with the same camera and telescope used to image the Sun (with a dense solar filter!) on the following day. ...

Еще в разделе: (Показать все результаты (>8708) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - Evalign
• SAL- Scientific Data Processing Visualization - Software Packages - EnSight
• APOD: October 4, 1999 - The 220 Mirrors of CRTF

PHP Manual . ... The switch statement is similar to a series of IF statements on the same expression. ... if ($i == 0) { print "i equals 0"; } if ($i == 1) { print "i equals 1"; } if ($i == 2) { print "i equals 2"; } switch ($i) { case 0: print "i equals 0"; break; case 1: print "i equals 1"; break; case 2: print "i equals 2"; break; } . ... Only when a case statement is found with a value that matches the value of the switch expression does PHP begin to execute the statements. ...

Еще в разделе: (Показать все результаты (>206) - oit.cmc.msu.ru/ )

• version_compare
• mcal_date_compare
• ldap_compare

... They include a carbonated diatreme and subvolcanic dykes and sills from the Beara peninsula along the south coast of Ireland, a carbonatite diatreme and related silicocarbonatite dykes from the Chagatai region in Uzbekistan and a selection of ultramafic lamprophyres, carbonatite dykes and calcite kimberlites from southern West Greenland. ... A small carbohydrothermal calcite carbonatite (0.80 wt % SrO ) with fenite cross-cuts the lamprophyre. ... Carbonatites and carbonatites and ? carbonatites . ...

Еще в разделе: (Показать все результаты (>835) - geo.web.ru/ )

• http://geo.web.ru/users/pavel/Publications/2002/Mironov2002.pdf
• http://geo.web.ru/conf/alkaline/2009/Savatenkov.htm
• http://geo.web.ru/conf/alkaline/2009/ZaitsevV4.htm

... Geophysical methods of the earth crust exploration . ... The Head of the Chair, Professor M.L.Vladov For those students who wish to specialize in the field of sesmics and geoacoustics the Chair offers an opportunity in two option areas: "Geophysical Methods of Investigation of the Earth's Crust" ("Seismometry") and "Geophysics" ("Marine Geophysics"). ... Russia, Moscow 119899, Vorobievy Gory, MSU, Faculty of Geology , Phone: (095)939-2970 Fax: (095)932-8889, E-mail: admin@geol.msu.ru . ...

Еще в разделе: (Показать все результаты (>123) - www.geol.msu.ru/ )

The method of gene expression analysis in complex morphological systems A.V. Klepikova, N.V. Demidenko, M.D. Logacheva, A.A. Penin M.V. Lomonosov Moscow State University, Moscow, Russia , annklepikova@gmail.com, demidenkonatalia@gmail.com, maria.log@gmail.com, alekseypenin@gmail.com Investigation of gene expression level is a powerful approach in functional genetics. ... 2010) Identification of genes correlated with early stage bladder cancer progression, Cancer Prev Res (Phila), 3(6):776ґ786. ...

Еще в разделе: (Показать все результаты (>293) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/101.pdf

How do Linux Threads compare with other OSs'? ... Solaris . ... Priority Scheduling [1] . ... Mutex Attributes . ... Thread Attributes . ... Posix and Solaris link thread priorities with mutexes and use the priority of a blocked thread's mutex to alter the priority of the blocking thread. Win32 and Linux let the scheduler determine what thread to elevate in priority. ... Solaris implements it because they need it: the program can change certain thread's attributes unless it is suspended. ...

Еще в разделе: (Показать все результаты (>405) - rtm-cs.sinp.msu.ru/ )

... Steganography can be used to store the data used in the image file (options /E and /X) Proposed directory for placement: /pub/os2/apps/graphics Your name: A. Doff Email address: m1@uni-one.nl Program contact name: (same) Program contact email: (same) Program URL: http://home.uni-one.nl/m1 Would you like the contact email address included in listings? no Operating System/Version: OS/2 Additional requirements: Replaces: /pub/os2/apps/graphics/belvoir13.zip ...

Еще в разделе: (Показать все результаты (>2332) - crydee.sai.msu.ru/ )

• Image: Nijo castle, Shogun palace. The main building. Comparing to temples and
• Analysis of a cosine wave
• Tutorial on Fortran 90, Digital UNIX

... The documentation of NatSkin is crap. ... It does not work (on my TWiki/Cairo installation). ... Why is the sidebar switched off during edit? ... Why are the topic actions named differently compared to standard TWiki? Does NatSkin support QuietSave? ... NatSkin once supported TWiki-2 (Beijing), TWiki-3 (Cairo) and TWiki-4 (Dakar) but has dropped support for Beijing and Cairo since version 3.0. ... Most probably you clicked on "Save" which saved your changes but keept you in the edit process. ...

Еще в разделе: (Показать все результаты (>31041) - dualopt1.cmm.msu.ru/ )

• NatSkinTemplates - TWiki - TWiki
• NatSkinTemplates - TWiki - TWiki - (printable)

... Head of Biochemistry department, Corresponding Member of Russian Academy of Sciences, Doctor of Science . ... The first line of investigation, started in mid-1980s, deals with analysis of the structure and properties of proteins involved in regulation of contractile activity of different muscle (troponins I and T, caldesmon, calponin). ... The third direction of investigation deals with the investigation of the structure and properties of human small heat shock proteins. ... Biochemistry. ...

Еще в разделе: (Показать все результаты (>136) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Immunochemistry as a tool
• Biochemistry Department of Moscow State University | History
• Measurement of B-type natriuretic peptide by two assays utilizing antibodies

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>204) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services
• Fasta3 help