... 2 : 1 ­ , 2 ­ : 1 : 1) Define the subject of intercultural communication. What is the difference between intercultural and cross-cultural communication? ... 2) Define culture. ... Explain the role of metaphor in culture studies. ... 4) Enumerate the basic functions of culture. ... 13) Comment on the acute problems of intercultural communication in the modern Russian society 2 : 1) Was Edward Hall right to define communication as culture and culture as communication? ... 2) Define communication. ...

Еще в разделе: (Показать все результаты (>107) - ffl.msu.ru/ )

• Research

Diploma thesis abstract «Spectral technique for organic solar cell efficiency measurement» Gavrik Alexey Yurievich Progress in organic photovoltaics manifests itself though rapid growth of the laboratory-made cell efficiency. ... Use of a common technique based on use of a silicon reference cell can lead to large errors for organic solar cell due to significant differences (e.g., spectral) between silicon reference and the organic test cell. ...

Еще в разделе: (Показать все результаты (>119) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Kulikov_Shmalhausen_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Gavrev_Magnitsky_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2016/Bychkov_Karabutov_en.pdf

MSU . Science Park . ... Prototyping center . ... Nowadays MSU Science Park provides office and laboratory premises in the center of Moscow in the close vicinity to the best University in Russia. ... One hundred twenty technological (IT, industrial engineering, medical devices and oil&gas services) companies are the residents of the Science Park. ... Five companies resident in MSU Science Park were listed amongst the top 50 by TechUspekh in their rating of the Top 100 innovative Russian companies. ...

Еще в разделе: (Показать все результаты (>12) - www.sciencepark.ru/ )

• MSU Science Park - Companies

Title of Presentation (Times New Roman 14 pt, bold, spacing 1.5, centered. ... Drawings: MS Word Picture format (embedded Excel Chart is too space consuming). Photographs: JPG file (600(600 dpi) embedded into MS Word (DO NOT use BMP format, it is too space consuming). ... References(Times New Roman 12 pt, bold, spacing 1, leave 6 pt before this paragraph) 1) First reference (Electrochimica Acta format) 2) Second reference (Electrochimica Acta format) ...

Еще в разделе: (Показать все результаты (>13) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/probst.pdf

... Магистерское образование . ... Магистерские программы . ... Магистерские программы (учебные планы) . ... Introduction to Cryptography . ... Basic requirements for data security in software systems. ... Lecturer: associate professor Primenko E. A. Mathematical Theory of Information . ... Addition operation of elliptic curve's points. f Postnikov's theorem.Theorems on the order of elliptic curve for certain types of primes. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>16) - hcs.cmc.msu.ru/ )

• Master program "Open Information Systems" | Магистерское и послевузовское
• Master program "Network Software" | Магистерское и послевузовское образование
• Master program "Mathematical Models of Complex Systems" | Магистерское и

... yes . ... Homing endonuclease . ... I-CreI . ... DNA methyltransferase . ... M.HhaI . ... Restriction endonuclease . ... EcoRV . ...

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Geometrical core
• Example of alignment
• Alignment example

Announcement On November 2-3, 2005 Lomonosov Moscow State University will conduct jointly with the Academy of Cryptography of the Russian Federation the Fourth All- Russian Conference Mathematics and Security of Information Technologies [Cybersecurity?] and jointly with the Center of International Studies, Cambridge University , United Kingdom, Advanced Research Workshop Unconventional ... Sherstyuk V.P. - Security Council of the Russian Federation; 3. ... Organization Committee 1. ...

Еще в разделе: (Показать все результаты (>15) - suny.msu.ru/ )

• http://suny.msu.ru/ru/ProgramMaBIT05En.doc

Summary of results and experience in Data Science Alexander P. Ryjov Associated Professor, Chair of Mathematical Foundations of Intelligent Systems, Department of Mechanics and Mathematics, Lomonosov Moscow State University, Professor and Head, Chair of Business Processes Management Systems, IT Business School, Russian Presidential Academy of National Economy and Public Administration. ... Systems for evaluation and monitoring of complex processes. ... Banks: credit scoring system. ...

Еще в разделе: (Показать все результаты (>73) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Strogalov Alexander Sergeevich :: Modeling
• Intelligent Systems :: Staff :: Nosov Valentin Alexandrovich :: History of

BNL PREPRINT BNL­QGS­98­0501 Study of Ї pp Baryon Exchange Processes V. L. Korotkikh 1;2 June 25, 1998 abstract The cross­section of the process Ї p + p ! ... ъ + + ъ \Gamma We repeated Barger and Cline's [3] calculation of reaction (3) and received the same 2 results at 10 GeV with their parameters: fi \Delta 8ъ = 0:10 GeV \Gamma1 ; s 0 = 2:85 GeV 2 ; ff \Delta (u) = 0:15 + 0:9 u: (5) The differential cross­section depends on these parameters as dЇoe du = 389:3 Їb ъ 2 s / fi \Delta 8ъ ! ...

Еще в разделе: (Показать все результаты (>71) - lav01.sinp.msu.ru/ )

• CERN, LHC Piont 5, CMS Control Room

. Wikipedia . Encyclopedia of Astronomy and Astrophysics . Encyclopedias Dictionaries . Encyclopedia.Com . "Krugosvet" . Different Encyclopaedias (in particularly Boljshaja Sovetskaja) . Encyclopaedia for children "Awanta+" . Britannica Encyclopaedia . BIMA Glossary . Glossary of Space Science Terms . Imagine the Universe! Dictionary A-D . Exploratorium Exhibit Cross Reference - Exhibit . Exploratorium Exhibit Cross Reference - Phenomena Index .

Еще в разделе: (Показать все результаты (>16) - astrometric.sai.msu.ru/ )

. Strict Standards : Only variables should be assigned by reference in /storage0/www/http/fengoffice/environment/classes/debug/BenchmarkTimer.class.php on line 273 . Strict Standards : Only variables should be assigned by reference in /storage0/www/http/fengoffice/environment/classes/debug/BenchmarkTimer.class.php on line 297 . Забыли пароль . E-mail адрес: . Выслать пароль ( Вход ) .

Еще в разделе: (Показать все результаты (>2) - aesc.msu.ru/ )

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>210) - www.msu.ru/ )

... Improvement of Methods and Means of Nonlinear Acoustics for Diagnostics of Concrete of Massive Items, Constructions and Structures . ... For want of distribution of elastic waves in a medium have heterogeneity (located defects, stratification, crack) the performances of an information signal, for example, velocity of distribution, amplitude, spectral component can change the parameters [1]. ... These performances are treated on the specially developed algorithm. ...

Еще в разделе: (Показать все результаты (>129) - acs366.phys.msu.su/ )

... About Journal | ... Sociology and Political Science publishes original works on sociology and political science, results of research and experiments in social and political spheres in Russia and abroad, methodological innovations, information about conferences, reviews of the recent books in sociology and political science. ... Please include full article title both in Russian and English. ... Information about the author/authors both in Russian and English. ... References. ...

Еще в разделе: (Показать все результаты (>43) - www.socio.msu.ru/ )

VIEWS Paul Murdin M T Wright Data, information and science I was one of almost half the IAU General Assembly that voted against the IAU resolution initiated by Elizabeth Griffin in Manchester in August 2000. ... The IUE archive, for example, delivers ultraviolet spectra into the hands of the community at the same rate that the satellite itself used to do, and papers frequently appear that are based on the archive. Other space missions like ISO and XMM have and are completing similar archives. ...

Еще в разделе: (Показать все результаты (>93) - hbar.phys.msu.ru/ )

• newtrev2.htm
• The jump of the second derivative of the moon's elongation
• Age Determinations by Radiocarbon Content: Checks with Samples of Known Age

... ОБЩИЕ СВЕДЕНИЯ О СЕТИ ИНТЕРНЕТ . ... Краткая история развития сети . История Интернет уходит своими корнями в ранний период развития компьютеров и компьютерных сетей. ... Осуществление таких жестких требований на практике стало возможным только путем использования уже существовавших компьютерных сетей. ... Но в сети Интернет возможно осуществить и более сложный режим пересылки информации с удаленного компьютера, получивший название протокола FTP (File Transfer Protocol). ...

Еще в разделе: (Показать все результаты (>15) - heritage.sai.msu.ru/ )

... Borexino . ... SCIENCE AND TECHNOLOGY OF BOREXINO: A REAL TIME DETECTOR FOR LOW ENERGY SOLAR NEUTRINOS (pdf) . Solar neutrino experiments and Borexino perspectives (pdf) . Detection of Supernova Neutrinos by Neutrino-Proton Elastic Scattering (pdf) . BOREXINO: A REAL TIME LIQUID SCINTILLATOR DETECTOR FOR LOW ENERGY SOLAR NEUTRINO STUDY (pdf) . Confronting Spin Flavor Solutions of the Solar Neutrino Problem with current and future solar neutrino data (pdf) . ... CAN 2.0 стандарт (pdf) . ...

Еще в разделе: (Показать все результаты (>3) - vserv.sinp.msu.ru/ )

... Mosekilde E. Department of Physics, Technical University of Denmark, Kgs. ... The purpose of this talk is to demonstrate the essential role that nonlinear dynamic phenomena play in normal physiological regulation and in the development of various diseases. ... Regulation of pressures and flows in the individual nephron involves the interaction between the tubuloglomerular feedback mechanism (TGF) and the oscillatory response of the activated afferent arteriole. ... 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>43) - www.msm.biophys.msu.ru/ )

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )